HMGIY / HMGA1 Antibody
Catalogue Number: LS-C746786-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | HMGA1, High mobility group protein A1, High mobility group protein R, HMG-R, Hmg-i, HMGIY, High mobility group AT-hook 1, HMG-I(Y), HMGA1A |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1). MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ |
| Application: | IF, WB, IHC |
Additional Text
Gene ID
3159
Gene Name
HMGA1
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Short Description
HMGA1 antibody LS-C746786 is an unconjugated rabbit polyclonal antibody to human HMGA1 (HMGIY). Validated for IF, IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 10kDa/11kDa/19kDa, while the observed MW by Western blot was 20kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations