CNR2 / CB2 Antibody
Catalogue Number: LS-C746791-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | CNR2, Cannabinoid receptor 2, CB2, CB2 cannabinoid receptor, CX5, CB2R, HCB2, Cannabinoid CB2 receptor, CB-2, CB2 receptor |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CNR2 (NP_001832.1). MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGV |
| Application: | WB |
Additional Text
Gene ID
1269
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Gene Name
CNR2
Short Description
CB2 antibody LS-C746791 is an unconjugated rabbit polyclonal antibody to CB2 (CNR2) from human. It is reactive with human, mouse and rat. Validated for WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 39kDa, while the observed MW by Western blot was 45kDa.
Concentration
0.422 mg/ml
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations