ATG9A Antibody
Catalogue Number: LS-C746845-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | ATG9A, APG9-like 1, Autophagy 9-like 1 protein, Autophagy-related protein 9A, MGD3208, MATG9, APG9 autophagy 9-like 1, APG9L1, Autophagy related 9A |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human ATG9A (NP_076990.4). WQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRI |
| Application: | IF, WB |
Additional Text
Gene Name
ATG9A
Antigen Type
Recombinant Protein
Gene ID
79065
Purification
Affinity Purified
Short Description
ATG9A antibody LS-C746845 is an unconjugated rabbit polyclonal antibody to ATG9A from human. It is reactive with human, mouse and rat. Validated for IF and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 60kDa/87kDa/94kDa, while the observed MW by Western blot was 50kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations