AKT1 Antibody
Catalogue Number: LS-C746867-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | AKT1, AKT, AKT-1, C-AKT, Pan-AKT, PKB alpha, PKBalpha, Proto-oncogene c-Akt, Protein kinase B, Rac protein kinase alpha, PRKBA, Protein kinase B alpha, RAC-PK-alpha, PKB, PKB-ALPHA, RAC, RAC-ALPHA |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-Terminus of human AKT1 (NP_005154.2). KEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
| Application: | IF, WB, IHC |
Additional Text
Gene ID
207
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Gene Name
AKT1
Short Description
AKT1 antibody LS-C746867 is an unconjugated rabbit polyclonal antibody to AKT1 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 48kDa/55kDa, while the observed MW by Western blot was 60kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations