H2AFX / H2AX Antibody
Catalogue Number: LS-C746881-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | H2AFX, H2AX, Histone H2A.x, H2A.X, H2A histone family, member X, H2AX histone |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human H2AFX (NP_002096.1). VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY |
| Application: | IF, WB, IHC |
Additional Text
Gene ID
3014
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Gene Name
H2ax
Short Description
H2AX antibody LS-C746881 is an unconjugated rabbit polyclonal antibody to H2AX (H2AFX) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 15kDa, while the observed MW by Western blot was 15kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations