TIMP3 Antibody
Catalogue Number: LS-C747218-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | TIMP3, HSMRK222, K222TA2, MIG-5 protein, K222, SFD, Metalloproteinase inhibitor 3, Protein MIG-5, TIMP-3 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human TIMP3 (NP_000353.1). YQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP |
| Application: | FC, WB |
Additional Text
Gene Name
TIMP3
Gene ID
7078
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Short Description
TIMP3 antibody LS-C747218 is an unconjugated rabbit polyclonal antibody to TIMP3 from human. It is reactive with human and rat. Validated for Flow and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 24kDa, while the observed MW by Western blot was 25kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations