GABARAP Antibody
Catalogue Number: LS-C747664-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | GABARAP, ATG8A, MM46, FLC3B, GABARAP-a |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1). MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE |
| Application: | WB, IHC |
Additional Text
Antigen Type
Synthetic Peptide
Purification
Affinity Purified
Gene ID
11337
Gene Name
GABARAP
Short Description
GABARAP antibody LS-C747664 is an unconjugated rabbit polyclonal antibody to GABARAP from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 13kDa, while the observed MW by Western blot was 14kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations