TEAD1 Antibody
Catalogue Number: LS-C748419-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | ChIP Validated Antibodies |
| Alias: | TEAD1, AA, Protein GT-IIC, TCF-13, TEAD-1, TEF-1, TEF1, TCF13, TEA domain family member 1, Transcription factor 13, NTEF-1, REF1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ul, 20 ul |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK |
| Application: | IF, ChIP, WB, IHC |
Additional Text
Gene Name
TEAD1
Antigen Type
Recombinant Protein
Concentration
0.57 mg/ml
Purification
Affinity Purified
Gene ID
7003
Short Description
TEAD1 antibody LS-C748419 is an unconjugated rabbit polyclonal antibody to TEAD1 from human. It is reactive with human and mouse. Validated for ChrIP, IF, IHC and WB.
Storage Note
Store at -20°C. Avoid freeze-thaw cycles.
Antibody Clonality
Polyclonal
Application Notes
The predicted MW is 40kDa/47kDa, while the observed MW by Western blot was 48kDa.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations