BCL2 / Bcl-2 Antibody (DY550)
Catalogue Number: LS-C756364-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | BCL2, Apoptosis regulator Bcl-2, B-cell CLL/lymphoma 2, B-cell lymphoma protein 2, Bcl-2, PPP1R50 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140 aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences. |
| Application: | FC |
Additional Text
Gene ID
596
Purification
Affinity Purified
Gene Name
BCL2
Short Description
Bcl-2 antibody LS-C756364 is a DY550-conjugated rabbit polyclonal antibody to human Bcl-2 (BCL2). Validated for Flow.
Antibody Clonality
Polyclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations