BCL2 / Bcl-2 Antibody (DY550)

Catalogue Number: LS-C756364-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Polyclonal Primary Antibody - Conjugated
Alias:BCL2, Apoptosis regulator Bcl-2, B-cell CLL/lymphoma 2, B-cell lymphoma protein 2, Bcl-2, PPP1R50
Shipping Condition:RT
Unit(s): 100 ug
Host name: Rabbit
Clone:
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140 aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
Application: FC

Additional Text

Gene ID

596

Purification

Affinity Purified

Gene Name

BCL2

Short Description

Bcl-2 antibody LS-C756364 is a DY550-conjugated rabbit polyclonal antibody to human Bcl-2 (BCL2). Validated for Flow.

Antibody Clonality

Polyclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.