BAX Antibody (DY488)
Catalogue Number: LS-C756378-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | BAX, BCL2-associated X protein, Bcl2-L-4, Apoptosis regulator BAX, Bcl-2-like protein 4, BCL2L4 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-Terminus of human Bax (17-48 aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids. |
| Application: | FC |
Additional Text
Gene ID
581
Purification
Affinity Purified
Gene Name
BAX
Short Description
BAX antibody LS-C756378 is a DY488-conjugated rabbit polyclonal antibody to human BAX. Validated for Flow.
Antibody Clonality
Polyclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations