CD5 Antibody (DY488)

Catalogue Number: LS-C756406-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Polyclonal Primary Antibody - Conjugated
Alias:CD5, CD5 antigen, CD5 antigen (p56-62), CD5 molecule, Lymphocyte antigen T1/Leu-1, LEU1, T1
Shipping Condition:RT
Unit(s): 100 ug
Host name: Rabbit
Clone:
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH).
Application: FC

Additional Text

Gene ID

921

Purification

Affinity Purified

Gene Name

CD5

Short Description

CD5 antibody LS-C756406 is a DY488-conjugated rabbit polyclonal antibody to human CD5. Validated for Flow.

Antibody Clonality

Polyclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.