Catalogue Number: LS-C756409-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | CD5, CD5 antigen, CD5 antigen (p56-62), CD5 molecule, Lymphocyte antigen T1/Leu-1, LEU1, T1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). |
| Application: | FC |
921
Affinity Purified
CD5
CD5 antibody LS-C756409 is a DY550-conjugated rabbit polyclonal antibody to human CD5. Validated for Flow.
Polyclonal
Store at 4°C. Do not freeze. Protect from light.
Applications should be user optimized.