ABCC8 / SUR1 Antibody (DY488)

Catalogue Number: LS-C756435-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Polyclonal Primary Antibody - Conjugated
Alias:ABCC8, ABC36, HI, PHHI, Sulfonylurea receptor, SUR, Sulfonylurea receptor 1, MRP8, SUR1delta2, HHF1, HRINS, SUR1, TNDM2
Shipping Condition:RT
Unit(s): 100 ug
Host name: Rabbit
Clone:
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
Application: FC

Additional Text

Gene Name

ABCC8

Purification

Affinity Purified

Gene ID

6833

Short Description

SUR1 antibody LS-C756435 is a DY488-conjugated rabbit polyclonal antibody to human SUR1 (ABCC8). Validated for Flow.

Antibody Clonality

Polyclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.