Catalogue Number: LS-C756435-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | ABCC8, ABC36, HI, PHHI, Sulfonylurea receptor, SUR, Sulfonylurea receptor 1, MRP8, SUR1delta2, HHF1, HRINS, SUR1, TNDM2 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA). |
| Application: | FC |
ABCC8
Affinity Purified
6833
SUR1 antibody LS-C756435 is a DY488-conjugated rabbit polyclonal antibody to human SUR1 (ABCC8). Validated for Flow.
Polyclonal
Store at 4°C. Do not freeze. Protect from light.
Applications should be user optimized.