CD209 / DC-SIGN Antibody (DY488)

Catalogue Number: LS-C756447-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Polyclonal Primary Antibody - Conjugated
Alias:CD209, CD209 antigen, CD209 molecule, CDSIGN, CLEC4L, DC-SIGN, HIV gpl20-binding protein, DC-SIGN1
Shipping Condition:RT
Unit(s): 100 ug
Host name: Rabbit
Clone:
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
Application: FC

Additional Text

Gene ID

30835

Purification

Affinity Purified

Gene Name

CD209

Short Description

DC-SIGN antibody LS-C756447 is a DY488-conjugated rabbit polyclonal antibody to human DC-SIGN (CD209). Validated for Flow.

Antibody Clonality

Polyclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.