Catalogue Number: LS-C756447-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | CD209, CD209 antigen, CD209 molecule, CDSIGN, CLEC4L, DC-SIGN, HIV gpl20-binding protein, DC-SIGN1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA). |
| Application: | FC |
30835
Affinity Purified
CD209
DC-SIGN antibody LS-C756447 is a DY488-conjugated rabbit polyclonal antibody to human DC-SIGN (CD209). Validated for Flow.
Polyclonal
Store at 4°C. Do not freeze. Protect from light.
Applications should be user optimized.