CCKBR / Cckb Antibody (DY550)
Catalogue Number: LS-C756503-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | CCKBR, CCKB, Cholecystokinin-2 receptor, CCK-BR, CCK2 receptor, CCK2-R, CCKB-R, Cholecystokinin-B, GASR, CCK-B, CCK-B receptor, CCK2R, Cckb receptor, CCKRB, Cholecystokinin B receptor, Gastrin receptor |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS). |
| Application: | FC |
Additional Text
Gene ID
887
Gene Name
CCKBR
Purification
Affinity Purified
Short Description
Cckb antibody LS-C756503 is a DY550-conjugated rabbit polyclonal antibody to human Cckb (CCKBR). Validated for Flow.
Antibody Clonality
Polyclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations