CCR3 Antibody (DY488)
Catalogue Number: LS-C756510-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | CCR3, C-C chemokine receptor type 3, B-chemokine receptor, CD193, CD193 antigen, Chemokine c-c motif receptor 3, C-C chemokine receptor 3, CKR3, CC-CKR-3, CCR-3, CMKBR3, Eosinophil eotaxin receptor, Eotaxin receptor, C-C CKR-3, CC chemokine receptor 3 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA). |
| Application: | FC |
Additional Text
Gene Name
CCR3
Gene ID
1232
Purification
Affinity Purified
Short Description
CCR3 antibody LS-C756510 is a DY488-conjugated rabbit polyclonal antibody to human CCR3. Validated for Flow.
Antibody Clonality
Polyclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations