Catalogue Number: LS-C756529-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | CHRNA3, AChR-alpha3, Acra-3, LNCR2, NAChR alpha 3, PAOD2, NACHRA3 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD). |
| Application: | FC |
CHRNA3
1136
Affinity Purified
CHRNA3 antibody LS-C756529 is a DY550-conjugated rabbit polyclonal antibody to human CHRNA3. Validated for Flow.
Polyclonal
Store at 4°C. Do not freeze. Protect from light.
Applications should be user optimized.