CYPOR / POR Antibody (DY550)

Catalogue Number: LS-C756534-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Polyclonal Primary Antibody - Conjugated
Alias:POR, CPR, CYPOR, p450R
Shipping Condition:RT
Unit(s): 100 ug
Host name: Rabbit
Clone:
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human POR(633-668 aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
Application: FC

Additional Text

Gene Name

POR

Purification

Affinity Purified

Gene ID

5447

Short Description

POR antibody LS-C756534 is a DY550-conjugated rabbit polyclonal antibody to human POR (CYPOR). Validated for Flow.

Antibody Clonality

Polyclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.