Catalogue Number: LS-C756534-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | POR, CPR, CYPOR, p450R |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-Terminus of human POR(633-668 aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids. |
| Application: | FC |
POR
Affinity Purified
5447
POR antibody LS-C756534 is a DY550-conjugated rabbit polyclonal antibody to human POR (CYPOR). Validated for Flow.
Polyclonal
Store at 4°C. Do not freeze. Protect from light.
Applications should be user optimized.