Catalogue Number: LS-C756598-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Polyclonal Primary Antibody - Conjugated |
| Alias: | BMP5, BMP-5, Bone morphogenetic protein 5 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-Terminus of human BMP5 (332-365 aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. |
| Application: | FC |
653
BMP5
Affinity Purified
BMP5 antibody LS-C756598 is a DY550-conjugated rabbit polyclonal antibody to human BMP5. Validated for Flow.
Polyclonal
Store at 4°C. Do not freeze. Protect from light.
Applications should be user optimized.