BMP5 Antibody (DY550)

Catalogue Number: LS-C756598-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Polyclonal Primary Antibody - Conjugated
Alias:BMP5, BMP-5, Bone morphogenetic protein 5
Shipping Condition:RT
Unit(s): 100 ug
Host name: Rabbit
Clone:
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human BMP5 (332-365 aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Application: FC

Additional Text

Gene ID

653

Gene Name

BMP5

Purification

Affinity Purified

Short Description

BMP5 antibody LS-C756598 is a DY550-conjugated rabbit polyclonal antibody to human BMP5. Validated for Flow.

Antibody Clonality

Polyclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.