EMD / Emerin Antibody (DY550)
Catalogue Number: LS-C756633-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Monoclonal Primary Antibody - Conjugated |
| Alias: | EMD, EDMD, Emerin, LEM domain containing 5, LEMD5, STA |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Mouse |
| Clone: | |
| Isotype: | IgG1 |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-Terminus of human Emerin (1-48 aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids. |
| Application: | FC |
Additional Text
Gene ID
2010
Purification
Affinity Purified
Gene Name
EMD
Short Description
Emerin antibody LS-C756633 is a DY550-conjugated mouse monoclonal antibody to human Emerin (EMD). Validated for Flow.
Antibody Clonality
Monoclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations