EMD / Emerin Antibody (DY488)

Catalogue Number: LS-C756636-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Monoclonal Primary Antibody - Conjugated
Alias:EMD, EDMD, Emerin, LEM domain containing 5, LEMD5, STA
Shipping Condition:RT
Unit(s): 100 ug
Host name: Mouse
Clone:
Isotype: IgG1
Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human Emerin (1-48 aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
Application: FC

Additional Text

Gene ID

2010

Purification

Affinity Purified

Gene Name

EMD

Short Description

Emerin antibody LS-C756636 is a DY488-conjugated mouse monoclonal antibody to human Emerin (EMD). Validated for Flow.

Antibody Clonality

Monoclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.