HSPA2 Antibody (DY488)

Catalogue Number: LS-C756637-LSP

Manufacturer:LifeSpan BioSciences Inc.
Preservative:0.02% Sodium azide
Type:Monoclonal Primary Antibody - Conjugated
Alias:HSPA2, Heat shock 70kD protein 2, HSP70-2, HSP70-3, Heat shock 70 kDa protein 2, Heat shock 70kDa protein 2
Shipping Condition:RT
Unit(s): 100 ug
Host name: Mouse
Clone:
Isotype: IgG1
Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Application: FC

Additional Text

Gene Name

HSPA2

Gene ID

3306

Purification

Affinity Purified

Short Description

HSPA2 antibody LS-C756637 is a DY488-conjugated mouse monoclonal antibody to human HSPA2. Validated for Flow.

Antibody Clonality

Monoclonal

Storage Note

Store at 4°C. Do not freeze. Protect from light.

Application Notes

Applications should be user optimized.