HSPA2 Antibody (DY550)
Catalogue Number: LS-C756639-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Monoclonal Primary Antibody - Conjugated |
| Alias: | HSPA2, Heat shock 70kD protein 2, HSP70-2, HSP70-3, Heat shock 70 kDa protein 2, Heat shock 70kDa protein 2 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Mouse |
| Clone: | |
| Isotype: | IgG1 |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences. |
| Application: | FC |
Additional Text
Gene Name
HSPA2
Gene ID
3306
Purification
Affinity Purified
Short Description
HSPA2 antibody LS-C756639 is a DY550-conjugated mouse monoclonal antibody to human HSPA2. Validated for Flow.
Antibody Clonality
Monoclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations