TCP1 Antibody (DY550)
Catalogue Number: LS-C756660-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.02% Sodium azide |
| Type: | Monoclonal Primary Antibody - Conjugated |
| Alias: | TCP1, CCTA, CCT-alpha, D6S230E, T-complex 1, TCP-1-alpha, Tailless complex polypeptide 1, CCT1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Mouse |
| Clone: | |
| Isotype: | IgG1 |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-Terminus of human TCP1 alpha (515-551 aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. |
| Application: | FC |
Additional Text
Gene Name
TCP1
Gene ID
6950
Purification
Affinity Purified
Short Description
TCP1 antibody LS-C756660 is a DY550-conjugated mouse monoclonal antibody to human TCP1. Validated for Flow.
Antibody Clonality
Monoclonal
Storage Note
Store at 4°C. Do not freeze. Protect from light.
Application Notes
Applications should be user optimized.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations