MSI1 / Musashi 1 Antibody
Catalogue Number: LS-C781935-LSP
| Manufacturer: | LifeSpan BioSciences Inc. |
| Preservative: | 0.025% Sodium azide |
| Physical state: | Lyophilized |
| Type: | Polyclonal Primary Antibody - Unconjugated |
| Alias: | MSI1, Musashi homolog 1 (Drosophila), Musashi RNA-binding protein 1, Musashi (Drosophila) homolog 1, Musashi1, Musashi 1, Musashi-1 |
| Shipping Condition: | RT |
| Unit(s): | 100 ug |
| Host name: | Rabbit |
| Clone: | |
| Isotype: | IgG |
| Immunogen: | Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody. |
| Application: | IHC-P, WB |
Additional Text
Gene ID
4440
Purification
Affinity Purified
Gene Name
MSI1
Short Description
Musashi 1 antibody LS-C781935 is an unconjugated rabbit polyclonal antibody to Musashi 1 (MSI1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Antibody Clonality
Polyclonal
Storage Note
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Application Notes
Optimal dilution of the Musashi antibody should be determined by the researcher.
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations