Peptide Substrates: PDKtide
Catalogue Number: P10-58-SCB
| Manufacturer: | SinoBiological SCB |
| Molecular Weight: | 4771.36 |
| Type: | Peptide Substrate |
| Alias: | NM_138923 |
| Shipping Condition: | Blue Ice |
| Unit(s): | 1 mg |
| Application: | KA |
Additional Text
Short Description
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Accession Number
NM_138923
SUPPORT
outstanding technical support
PRODUCT
we offer a full product guarantee
DELIVERY
we offer free delivery to UK universities and non profit organisations