Diapause-specific, recombinant venom peptide

Catalogue Number: VP0003-NZY

Manufacturer:NZYTech
Molecular Weight:44,7 KDa
Type:Peptide
Shipping Condition:Blue Ice
Storage Condition:2-8°C
Unit(s): 0.15 mg

Description

Description: Diapause-specific venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Gastrophysa atrocyanea (leaf beetle). The endogenous diapausespecific peptide has attractive properties, such as antifungal activity, N-type voltage-gated Ca 2+ channel blocker and has high homology with amino acid sequences encoded in the insect iridescent virus. Tanaka et al. suggest that diapause-specific peptide can be utilized as a probe to analyse functional and evolutional of the life cycles of insects and iridoviruses. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.3 mg/mL concentration. Sequence: DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW

Additional Text

Short Description

Sequence: DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW