Diapause-specific, recombinant venom peptide

Catalogue Number: VP0003-NZY

Manufacturer:	NZYTech
Type:	Peptide
Shipping Condition:	Blue Ice
Storage Condition:	2-8°C
Unit(s):	0.15 mg

Overview

Description

Description: Diapause-specific venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Gastrophysa atrocyanea (leaf beetle). The endogenous diapausespecific peptide has attractive properties, such as antifungal activity, N-type voltage-gated Ca 2+ channel blocker and has high homology with amino acid sequences encoded in the insect iridescent virus. Tanaka et al. suggest that diapause-specific peptide can be utilized as a probe to analyse functional and evolutional of the life cycles of insects and iridoviruses. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.3 mg/mL concentration. Sequence: DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW

Additional Text

Short Description

Sequence: DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW

Price

£468.00

-

Quantity
Unit Size

Find out about delivery