› › Absolute Antibody

Absolute Antibody was founded in 2012 with a vision to make engineered recombinant antibodies accessible to all, and we remain the only company 100% focused on recombinant antibody technology. Though recombinant antibodies are standard in the pharmaceutical industry, these antibodies have not been as widely available for diagnostics or research. This is starting to change, however, due to the many advantages recombinant antibodies offer over traditional hybridoma-produced monoclonal antibodies.

Absolute Antibody has been at the forefront of the movement to make recombinant antibodies more readily available to all. In 2015, we were recognized in a Nature paper on the need to standardize research antibodies, and in 2018, we co-authored a mAbs Journal paper further illustrating the importance of using recombinant antibodies. Over the years, we have grown rapidly as demand for recombinant antibodies increases.

We specialize in antibody sequencing, engineering and recombinant expression, offering royalty-free custom services and a unique reagents catalog of engineered recombinant antibodies and Fc Fusion proteins. Our customers include leading pharmaceutical, biotechnology and diagnostics companies, as well as academic researchers worldwide; we have customers in 65 different countries and have sold to 14 of the top 15 pharmaceutical companies by revenue. This international customer base is served by our ISO 9001:2015-certified manufacturing facility in Northeast England and additional offices in Boston in the United States and Amsterdam in the Netherlands.

The Absolute Antibody team has deep experience in the therapeutic antibody and recombinant technology fields. Together, we have the knowledge and expertise to deliver high-quality products and services, as well as offer high-level consultation on our customers’ antibody development projects. Since our founding, we have produced more than 180 different antibody formats for our customers, as well as developed a reagents catalog of more than 13,000 engineered recombinant antibodies. For an example, check out one catalog clone (anti-EGFR, or Cetuximab) available in more than 30 different off-the-shelf formats.

In 2020, we received a Queen’s Award for Enterprise in International Trade for our rapid international expansion. To date, we have sequenced more than 5,000 hybridomas, completed more than 125 successful antibody humanization projects, and manufactured more than 21,000 different antibodies, making 865 grams of protein in total. We look forward to continuing this growth and working toward our vision of Engineered Recombinant Antibodies for All.

Product Literature
View All Products

Antibody Sequencing, Engineering & Recombinant Expression

Recombinant Reagents Catalog Any Species, Any Isotype

Products

Primary Antibodies
Secondary Antibodies
Recombinant Proteins

Technology

Why Go Recombinant?

The vast majority of reagent monoclonal antibodies are generated from hybridomas, immortal antibody-producing cells created by fusing a tumor (myeloma) cell with an antibody-producing B cell from an immunized animal. However, hybridomas suffer from many limitations. They can undergo genetic drift, leading to batch-to-batch variability; they can be genetically unstable and stop expressing the antibody; and more than 30% of hybridomas contain additional antibody genes, meaning they are not actually monoclonal.

In contrast, recombinant antibodies are manufactured using synthetic genes expressed in a defined in vitro cell line. They offer a variety of benefits compared to traditional hybridoma-produced antibodies.

  • Ensured reproducibility
    Recombinant antibodies are absolutely defined by amino acid sequence, ensuring batch-to-batch reproducibility. View data confirming reproducibility between antibody manufacturing lots in our application note.
  • Biological definition
    Recent research has shown that more than 30% of traditional hybridoma-derived antibodies are not actually monoclonal, leading to problems with binding specificity, affinity and reproducibility. In contrast, recombinant antibodies are truly biologically defined, with no variation in heavy or light chains; you know exactly what is in each and every vial.
  • High purity
    Our recombinant antibodies are expressed in a chemically defined, serum-free mammalian expression system, eliminating contamination from serum components and resulting in highly pure antibodies with low endotoxin levels.
  • Added antibody value
    Recombinant antibodies can be engineered into new formats, extending antibody usefulness and opening up new experimental possibilities for in vitro and in vivo use. Antibody engineering options include:

    • Switching to different species, isotypes and subtypes
    • Creating antibody fragments, bispecifics and trispecifics
    • Developing chimeric and humanized antibodies
    • Producing Fc Silent™ versions to reduce non-specific staining
  • Animal-free manufacturing
    Our recombinant antibodies are manufactured in vitro using synthetic genes, an entirely animal-free process. This alleviates animal welfare concerns associated with traditional monoclonal antibody manufacturing.
  • Security
    Unlike hybridomas, recombinant antibodies are not susceptible to contamination, genetic drift or accidental loss. With a known sequence, recombinant antibodies can always be reproduced for further use.

Looking to learn more about the benefits of recombinant antibodies? We answer the question “Why Go Recombinant?” in the below presentation, explaining how engineered recombinant antibodies allow researchers to improve experimental design and develop complex controls with absolute precision.

Our Recombinant Technology

Absolute Antibody specializes in antibody sequencing, engineering and recombinant expression, producing an ever-increasing number of engineered recombinant antibodies at our ISO-certified antibody manufacturing facility. We’ve used our custom-built technology platform to develop a unique recombinant reagents catalog and provide antibody services to customers worldwide, demonstrating we have the technology, expertise and capacity to meet the growing demand for recombinant antibody technology.

Our Antibody Production Platform

Our HEXpress™ antibody expression platform rapidly produces high-quality antibodies at milligram-to-gram scale. This custom-built production platform includes our proprietary vectors, cloning system, and high-yielding mammalian cell lines. We use serum-free transient expression as a faster, more affordable alternative to stable CHO cell line generation, and can scale up to multi-gram quantities in a matter of weeks.

Our production platform can manufacture recombinant antibodies in any species, isotype or format, including multispecifics and fragments, with high purity and low endotoxin levels. This platform has enabled us to produce more than 21,000 different recombinant antibodies, making 865 grams of protein in total. In addition, we’ve used the platform to build our own catalog of more than 13,000 antibodies in recombinant engineered formats. For example, check out one catalog clone (anti-EGFR, or Cetuximab) available in more than 30 different off-the-shelf formats.

We’ve continued to increase our antibody production capacity in recent years, developing custom high-throughput purification robots as well as implementing a third production line that can recombinantly manufacture hundreds of different antibodies per week. To learn more about the development of our production platform, view a presentation from our CSO describing how we have scaled and optimized our antibody expression and purification systems.

Our Antibody Engineering Technology

We have developed a proprietary cloning system to enable rapid reformatting of antibodies into almost any format. This allows antibody engineering such as species, isotype or subtype switching; bispecific or trispecific antibodies; antibody fragments; chimerization and humanization; engineered Fc domains; and Fc fusion proteins. Learn more about our engineering services here, or view the 180+ different formats we have created here.

In addition, we don’t just produce existing antibody formats; we create and offer novel antibody engineering technologies to our customers. Our own novel technologies include:

  • Fc Silent™ antibodies, which have a genetically engineered Fc domain with key point mutations that abrogate binding of Fc receptors and abolish ADCC effector function.
  • AbFab2™ antibody fragments, recombinant Fab2 fragments with a proprietary dimerization motif in place of the hinge region to remove contaminating byproducts and improve antibody stability.
  • Prometheus™ antibody humanization, a humanization platform uniquely focused on enhancing antibody manufacturability, leading to increased expression, lower aggregation, and long-term stability and solubility. We have completed more than 120 successful humanization projects to date.

History of Innovation Timeline

If you want to learn more about the development of our recombinant antibody technology platform, check out our History of Innovation timeline below

Our Hybridoma Sequencing Approach

We’ve developed a cutting-edge high-throughput (NGS) approach to hybridoma sequencing that delivers all variable domains present within a hybridoma, as well as a full analysis characterizing the hybridoma’s sequences and any heterogeneity present. The technology works on any species or isotype, and can rescue contaminated or non-viable cells.

Hybridoma sequencing protects valuable antibodies against contamination, genetic drift, accidental loss, and other unforeseen circumstances, securing customers’ antibody supply chains long-term. We have a large capacity and high success rate: we have sequenced more than 5,000 hybridomas.  We also offer customers antibody protein sequencing when the hybridoma is unavailable, as well as a pioneering polyclonal sequencing service.

Formats We Have Made

At Absolute Antibody, we have experience producing antibodies in a wide range of formats. Using our proprietary cloning system, we have manufactured more than 180 different antibody formats for customers around the world. We provide both custom antibody engineering services as well as a rapidly growing catalog of engineered recombinant antibodies.

Our Periodic Table of Antibodies represents most of the formats we have created to date. Explore our interactive Periodic Table of Antibodies

You can also follow the links below to learn more about some of the key formats:

Antibody Fragments

Absolute Antibody’s recombinant antibody technology allows us to convert any antibody into a fragment, including single chain Fv (scFv), Fab or Fab2 formats. Antibody fragments offer an ideal alternative to full-length antibodies in certain situations, as they enable better tissue penetration, reduce non-specific binding, and increase antibody stability and solubility. Antibody fragments can also improve localization in super-resolution methods, or reduce false positives in sandwich ELISA-type diagnostic tests.

Our recombinant antibody catalog includes popular clones engineered into various fragment formats, while our custom engineering service enables the creation of fragments from any existing antibody. Contact us to discuss your project!

Below, we provide some additional details on our approach to the Fab2 format.

Spotlight on: Fab2 Antibodies

Fab2 antibody fragments are used in many applications or assays where the presence of the Fc region may cause problems. They are traditionally made by enzymatic cleavage of full-length antibodies, but this causes a range of contaminants as by-products and the resulting fragment is comparatively unstable.

At Absolute Antibody, we produce Fab2 antibodies recombinantly. Our recombinant version, called the AbFab2™ fragment, has a proprietary dimerization motif in place of the hinge region, which improves stability of the fragment. Contaminating fragments are not generated, and a His tag is added for purification. As with all recombinant antibodies, the fragments are chemically defined with high purity and ensured batch-to-batch reproducibility.

See the figure below to compare the standard industry approach to the Absolute Antibody approach. In addition, the below ELISA data demonstrates that our Fab2 antibodies have nearly identical behavior to the original IgG antibodies.

Competition ELISA comparing affinity of different anti-cmyc (9E10, Ab00100) variants: 1.25 μM solutions of murine IgG1 (green), murine Fab2 (black) or human Fab (blue) 9E10 variants were pre-mixed with different concentrations of murine IgG1 9E10:HRP conjugate. These mixtures were then used to probe wells coated with immobilized multi-tag protein (Pr00106). The stronger the binding of the 9E10 variants, the higher the concentration of 9E10:HRP conjugate had to be in order to observe a signal. The weakest binder was hFab, while Absolute Antibody’s Fab2 and mIgG1 behaved almost identically.

Chimeric Antibodies

Chimeric antibodies consist of an antibody’s original antigen-binding variable domains with the constant domains from a different species. At Absolute Antibody, we offer an antibody chimerization service for almost any mammalian species, in particular human, mouse, rat, rabbit and hamster IgG with other species and isotypes available on request.

Chimeric antibodies retain the original antibody’s antigen specificity and affinity and are valuable tools for in vivo and in vitro research, as well as diagnostic assay development.

In Vivo Research

  • Biotherapeutic research
    Many therapeutic monoclonal antibodies were originally generated in mice and chimerized to reduce immunogenicity in humans, before humanization was widely adopted. Examples of chimeric antibodies in the clinic include infliximab, rituximab and abciximab. Chimeric antibodies containing human constant domains and mouse variable domains are substantially cheaper than fully humanized antibodies. This makes them useful at the early stages of biotherapeutics research.

    Example products: our research-grade biosimilars, available with human, mouse, rabbit, rhesus monkey and cynomolgus monkey constant domains
  • Improved in vivo performance
    Species-matched chimeric antibodies reduce anti-species immune responses in animal models. Quite often antibodies may be generated in one species, for example rat, and the disease animal model being used may be another, for example mouse. Here, a chimeric antibody with mouse constant regions (partially “murinized”) will result in reduced immunogenicity. For example, this case study illustrates how a species-matched, mouse-anti-mouse antibody was able to deplete CD8+ T-cells in mice more completely and for longer than the traditional rat monoclonal.

    Example products: our immunotherapy antibodies, all available in mouse-anti-mouse format

In Vitro Research

  • Chimerization allows antibodies to be tailored to specific applications, as they are not limited to the original antibody species. Chimeric antibodies therefore give researchers the flexibility to adapt the monoclonal antibody of their choice to any platform or binding module/surface. In flow cytometry and IHC applications, for example, chimeric antibodies can circumvent potential non-specific binding issues associated with binding of secondary antibodies to the test cell or tissue. For immunofluorescence applications, chimeric antibodies can enable easier co-labelling studies.

    Example products: we have generated a family of anti-myc tag antibodies for use as controls or affinity capture antibodies. The original anti-c-myc antibody [9E10] is a mouse monoclonal; it is now available off-the-shelf with human, rat, rabbit, goat or hamster constant domains.

Diagnostic Assay Development

  • Use as serological controls in immunoassays
    Serological immunoassays designed to detect a specific antibody in patient samples rely on serum calibrators (standards) and/or positive controls. Calibrators are used to generate standard curves to quantify the test antibody concentration in the patient serum, or as positive controls to assess the performance of the assay and reagents. For a serological assay, calibrators are derived from seropositive serum or plasma and are heterogeneous by nature. As a result, they suffer from significant drawbacks, including lot-to-lot variability, sourcing difficulties, and characterization limitations.

    Recombinant chimeric antibodies are a more reliable alternative to serum-based calibrators. Advantages include batch-to-batch reproducibility, homogeneous specificity and affinity, and the ability to generate fully characterized antibodies in unlimited quantities.

    Example products: our IgE Fc Proteins, used to create reproducible control sera by spiking the IgE into normal sera, are available in species such as human, mouse, dog, cat and horse.
  • Reduce interference from heterophilic antibodies
    Heterophilic antibodies, poly-reactive antibodies recognizing IgG from different animal species, are found in human patient serum and plasma. These antibodies are non-specific, have no defined antigen, and can bind to the Fc region of the assay antibody, causing a false positive test signal. Heterophilic antibodies found in patient serum react with rat and mouse IgG (often called human anti-mouse antibodies or HAMA). Since conventional high affinity monoclonal antibodies are only obtained from mice and rats, heterophilic antibodies can be a limitation in diagnostic tests. Human chimeric antibodies are a solution to this problem.

    Example products: we offer various anti-allergen antibodies of interest to diagnostic assay developers, available with human constant domains.

Interested in chimeric antibodies? Our recombinant antibody catalog includes products in a wide range of species, or we can convert any antibody into any species upon request – contact us to get started!

Non-IgG Isotypes

Antibodies of IgG isotype are the most commonly used antibodies in research, diagnostics and therapy. Upon hearing the word antibody, most of us will instantly think of those Y-shaped depictions of antibody-proteins meant to reflect the shape of IgG.

Yet nature offers a range of other formats with unique characteristics, which our recombinant antibody technology allows researchers to explore. Switching an antibody’s isotype or subtype might enable you to tailor effector function, reduce the number of needed controls, or open up new areas of investigation in allergy or autoimmunity research.
In addition to all IgG subtypes, we offer antibodies in the following isotypes:

  • IgM: the predominant antibody in the primary immune response, which can present as a pentamer or hexamer in solution and as a monomer on the surface of B-cells.
  • IgA: the predominant antibody in mucous secretions such as saliva, tears, milk and intestinal juice. It is involved in preventing opportunistic pathogens from entering through mucosal barriers. It can be found in a monomeric or dimeric form.
  • IgE: has two additional constant domains in place of the hinge region. It plays an important role in defense against parasites, and is also a key mediator of Type I hypersensitivity reactions or allergies.
  • IgD: thought to be involved in transduction of activating signals, though other functions of IgD may still be discovered. Found predominantly on the surface of B-cells, it has a similar structure to IgG, but with an extended hinge region that is very susceptible to proteolytic digestion.
  • IgY: the major immunoglobulin class in birds, reptiles, amphibians and lungfish.

Learn more about antibody isotypes and subtypes in our Antibody Resource, a free online reference resource for researchers.

Interested in a non-IgG antibody? In our recombinant antibody catalog, you can find clones engineered into different isotypes and subtypes, available for purchase off-the-shelf. We can also convert any antibody into any isotype or subtype upon request – contact us to get started!

Fc Silent™ Antibodies

Fc Silent™ represents a genetically engineered Fc domain developed at Absolute Antibody for research and assay development. It contains key point mutations that abrogate binding of Fc receptors (FcγR, FcR), abolishing antibody directed cytotoxicity (ADCC) effector function.

Our Fc Silent™ antibodies therefore enable researchers to remove effector function in vivo and reduce non-specific background in staining methods. In vivo, the antibodies benefit from the long plasma half-life (t1/2) associated with the Fc domain, with none of the cytolytic immune effector mechanisms associated with the wild-type Fc domain. In vitro, the antibodies can be used for flow cytometry and immunohistochemistry (IHC) applications to reduce non-specific background signal resulting from Fc receptor binding. The Fc Silent™ mutations do not affect other properties of the antibody, including their compatibility with secondary antibodies.

All Absolute Antibody antibodies and fusion proteins are available with the Fc Silent™ domain. Our reagents catalog includes species-specific Fc Silent™ domains, such as human, mouse, rabbit, rat and hamster, in stock and ready to purchase. If you don’t see your antibody of choice in the Fc Silent™ format, contact us – we’d be happy to produce it for you!

Fc Silent™ Binding Data

Mouse IgG2a and rat IgG2b isotypes are known to bind strongly to Fc receptors irrespective of the test antibody specificity. Isotype controls are employed to allow the researcher to distinguish between specific and non-specific background signals. In Figure 1, we show how murine macrophages are labelled almost as strongly by a rat IgG2b isotype control as by an anti-F4/80. Switching to Fc Silent™ antibodies results in reliable data with background staining indistinguishable from a secondary-antibody-only control. This also shows that Fc Silent™ antibodies are compatible with standard secondary antibodies.

Figure 2 uses surface plasmon resonance (SPR) and direct competitive inhibition ELISA to show that the Fc Silent™ format does not interact with murine or human Fc receptors. This data was provided by Dr. Stephen Beers at the University of Southampton.

Figure 1. Flow cytometry of BMDMs stained with wild-type (A) and Fc Silent™ (B) anti-F4/80 (Ab00106-8.1 and Ab00106-8.4) and isotype control antibodies, followed by fluorescently conjugated goat anti-rat secondary antibody. Using Fc Silent™ abolishes non-specific FcγR driven staining, making data cleaner and more accurate.

 

 

 

 

 

 

 

 

 

Figure 2A and B. Sensogram showing binding of mouse wild-type and Fc Silent™ anti-F4/80 IgG2a monoclonal antibodies (Ab00106-2.0 and Ab00106-2.3, respectively) to immobilized mouse low and high affinity Fcγ receptors (CD16, CD16-2, CD32, CD64). Biacore SPR binding analysis shows that the Fc Silent™ antibody has lost its capacity to interact with the mouse Fc receptors.

Figure 2C and D. Sensogram showing binding of rat wild-type and Fc Silent™ anti-F4/80 monoclonal antibodies (Ab00106-8.1 and Ab00106-8.4, respectively) to immobilized mouse low and high affinity Fcγ receptors (CD16, CD16-2, CD32, CD64). Biacore SPR binding analysis shows that the Fc Silent™ antibody has lost its capacity to interact with the mouse Fc receptors.

Figure 2E. Direct competitive inhibition ELISA. 2µg/ml/well of human recombinant FcγR1 receptor (rCD64) was absorbed onto a 96-well plate. 40µg/ml biotinylated Alemtuzumab (Campath) was premixed with un-labelled serially diluted murine wild-type or Fc Silent™ anti-F4/80 [CI:A3-1] IgG2a monoclonal antibodies (Ab00106-2.0 or Ab00106-2.3, respectively) or Alemtuzumab (Campath; positive control). The data clearly show that the Fc Silent™ antibody, Ab00106-2.3, does not bind to the human Fc receptor.

mAbsolve Fc Silencing Technology

Fc-mediated immune effector functions are an important part of an antibody’s natural function, but in many therapeutic antibodies, these interactions are not desirable and can lead to catastrophic side effects. Many approaches to eliminate effector function have been developed, but none completely silence the unwanted binding to Fc gamma receptors, except for one. The STR Fc silencing platform, developed by mAbsolve and former Absolute Antibody scientists, delivers the only truly silent Fc mutations described to date. The technology therefore has the potential to improve the safety and efficacy of therapeutic antibodies and Fc fusion proteins.

  • Comprises 3 mutations in the Fc domain
  • Can be applied to any IgG based antibody or other Fc-fusion protein
  • STR retains all the favorable attributes of an Fc domain, except for Fc receptor and C1q binding

 

Binding of IgG1 variants to human FcyRI (CD64). STR is the first variant to completely eliminate binding to all Fc receptors, including FcyRI.

Additional information available in the PLOS One research article “Fc-engineered antibodies with immune effector functions completely abolished.”

Benefits of producing STR-modified recombinant antibodies with Absolute Antibody

  • Scientific advisors involved in STR technology development
  • Off-the-shelf reference antibodies and isotype controls available for purchase
  • Access to a research license for early-stage therapeutic development without an ongoing fee
  • Technical support from the mAbsolve and Absolute Antibody teams
  • Industry-leading recombinant antibody engineering services

Off-the-shelf STR silenced antibodies

Animal-Free Antibodies

Polyclonal antibodies and hybridoma-derived antibodies are made using animals. While this practice has brought us many great reagents and enabled important discoveries, many scientists are uneasy with the use of animals for the creation of their tools. Moreover, many funding bodies are pushing toward the use of reagents made without the use of animals or animal-derived components (e.g. serum).

As a result, the animal-free antibody movement has been gaining more and more traction in recent years, as supported by a recent letter on animal-free antibody alternatives published in Nature Biotechnology. Since our founding in 2012, Absolute Antibody has been at the forefront of making animal-free recombinant antibodies more readily available for research and diagnostic applications. We are now active members of committees to promote the use of animal-free recombinant antibodies, such as the US National Institutes of Health’s Interagency Coordinating Committee on the Validation of Alternative Methods.

The recombinant production platform we use at Absolute Antibody is completely animal and animal-component free. The platform is based on transient, chemical transfection of a HEK293 cell line cultured in a precisely defined, serum-free medium. We do not use viral transfection approaches. This process is used for both our custom antibody expression service, as well as to produce all the reagents in our rapidly growing catalog of recombinant antibodies and proteins.

Our reagents portfolio contains antibodies from diverse sources, including classic hybridomas which have been sequenced for re-creation via recombinant production. This means that while the reagent was originally discovered by immunizing an animal, the products available for purchase are completely animal-free. Other sources of antibodies include human B-cell sequencing, as well as antibodies discovered by phage display.

also support the sequencing of existing hybridoma and ascites-derived antibodies to enable animal-free recombinant production. We provide high-throughput (NGS) hybridoma sequencing and antibody protein sequencing services to customers worldwide. To learn more about sequencing existing antibodies, view our presentation, given as part of a webinar series organized by the US National Toxicology Program Interagency Center for the Evaluation of Alternative Toxicological Methods (NICEATM), the PETA International Science Consortium Ltd., and the European Union Reference Laboratory for alternatives to animal testing (EURL ECVAM).

If you want or need antibodies or proteins that have been made without animals or animal-derived components, you can be assured that every product available from Absolute Antibody will suit your requirements.

Primary Antibodies

Anti-Allergen Antibodies

Antibodies form a powerful tool used by the immune system to protect us from various pathogens. However, antibodies can also have deleterious effects, as very widely demonstrated by type I hypersensitivity reactions, in particular what we commonly refer to as “allergies”.

Be it to pollen, bee stings or various foods – allergies are extremely common, with various theories as to why they appear to be on the increase.

To cater to researchers investigating allergies, we offer a range of antibodies against common allergens. Many of these antibodies have been shown to compete with naturally occurring IgE – the principal antibody isotype mediating allergies. We offer these antibodies as human IgE (along with antibodies against IgE itself) for use as calibrators and positive controls.

 

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-Almond Allergen [X151] Almond), Prunus dulcis (Amygdalus dulcis ELISA
Anti-Almond Allergen [X50] Almond), Prunus dulcis (Amygdalus dulci ELISA
Anti-Amphibian Allergen [X359] Amphibia ELISA
Anti-Api m 2 [21E11] Honeybee (Apis mellifera) crystallization, ELISA
Anti-Ara h 2 [PA12P3D08] Peanut (Arachis hypogaea) biolayer interferometry, ELISA
Anti-Ara h 2/Ara h 3 [PA12P3F10] Peanut (Arachis hypogaea) biolayer interferometry, ELISA
Anti-Asp f 1 [14H4] Aspergillus fumigatus (Neosartorya fumigata) IP, WB, ELISA
Anti-Asp f 1 [17A5] Aspergillus fumigatus (Neosartorya fumigata) IP, WB, ELISA
Anti-Asp f 1 [4F8] Aspergillus fumigatus (Neosartorya fumigata) IP, WB, ELISA
Anti-Asp f9 [5C6] Aspergillus fumigatus (Neosartorya fumigata) IP, WB, ELISA
Anti-Bet v 1 [BAB2] Activate, WB, ELISA Activate, WB, ELISA
Anti-Bet v 1 [BAB3] Birch (Betula pendula) WB, ELISA
Anti-Bet v 1 [BAB4] Birch (Betula pendula) WB, ELISA
Anti-Bet v 1 [BAB5] Birch (Betula pendula) WB, ELISA
Anti-Bet v 1 [BV16] Birch (Betula pendula) crystallography, WB, ELISA
Anti-Bet v 1 [M0418] Birch (Betula pendula) crystallography, ELISA
Anti-Bla g 1 [Bla g 1-scFv] German Cockroach (B. germanica) crystallography, ELISA
Anti-Bla g 2 [4C3] German Cockroach (B. germanica) crystallography, ELISA
Anti-Bla g 2 [7C11] German Cockroach (B. germanica) crystallography, ELISA
Anti-Bos d 5 [D1] Cow (Bos taurus) crystallization
Anti-C3a Receptor [D098G01] Human
Anti-C3a Receptor [D1858G07] Human
Anti-Cashew Allergen [X467] Anacardium occidentale (Cashew) ELISA
Anti-Celery Allergen [X474] Apium graveolens (Celery) ELISA
Anti-Coconut Allergen [X423] Cocos nucifera (Coconut) ELISA
Anti-Der f 1 [6A8] Dust Mite (Dermatophagoides farinae) crystallization, ELISA
Anti-Der p 1 [10B9] Dust Mite (Dermatophagoides farinae) crystallization, ELISA
Anti-Der p 1 [5H8] Dust Mite (Dermatophagoides farinae) crystallization, ELISA
Anti-Der p 1, Der f 1 [4C1] House Dust Mite ELISA
Anti-Der p 2 [H10] Dermatophagoides pteronyssinus chimera studies, SPR
Anti-Der p 2 [H5] Dermatophagoides pteronyssinus chimera studies, SPR
Anti-Der p 7 [WH9] House Dust Mite Block, ELISA
Anti-Fc epsilon R [IB10] Human Block, FC
Anti-Fc epsilon R [IE7] Human FC
Anti-FceR1 alpha [Mar-1] Mouse deplete, IP, FC, IHC
Anti-Fel d 1 [REGN1909] Cat (Felis catus) crystallization, functional assay, SPR, Block, ELISA
Anti-Gliadin [1E01] barley, rye, spelt, triticale, Wheat AlphaLISA, ELISA, FC
Anti-Gliadin [1E03] barley, rye, spelt, triticale, Wheat AlphaLISA, ELISA, FC
Anti-Gliadin [PEE14C7] barley, rye, spelt, triticale, Wheat ELISA
Anti-Gliadin [VHH26] barley, rye, spelt, triticale, Wheat ELISA
Anti-Hev b 6.02 [G7] Para rubber tree (Hevea brasiliensis) ELISA
Anti-Hev b 6.02 [H8] Para rubber tree (Hevea brasiliensis) ELISA
Anti-Hev b 6.02 [M8] Para rubber tree (Hevea brasiliensis) ELISA
Anti-Homer1 [HC89] Mouse WB, ELISA, IF, IHC
Anti-Homer1 [HS22] Mouse WB, ELISA, IF, IHC
Anti-Homer1 [HS38] Mouse WB, ELISA, IF, IHC
Anti-Homer1 [HS63] Mouse WB, ELISA, IF, IHC
Anti-IDO1 [19C5] Human ELISA, IHC
Anti-IgE [D9#3116] Dog WB, ELISA
Anti-IgE [huMaE11 (Omalizumab)] Human crystallization, Block, ELISA
Anti-IgE [mAbA9] Mouse Blocking, ELISA, FC
Anti-IgE [TES-C21] Human Block, ELISA
Anti-IL-12p40 [Antibody 80] Human functional assay, inhibit, neutralize, therapeutic, ELISA
Anti-IL-1B [IC8] Human neutralize
Anti-IL-1B [MAb201] Human ICC, inhibit, neutralize, WB
Anti-IL-33 [309h] Human functional assay, inhibit, Block, ELISA
Anti-IL-33 [874F7-Hu1] Human, Cynomolgus Monkey, Mouse functional assay, inhibit, neutralize, Block, ELISA
Anti-IL-33 [H02-8F11Hz01] Human, Cynomolgus Monkey, Mouse functional assay, inhibit, Block, ELISA
Anti-IL-33 [W3759-cAb1] Human ELISA
Anti-IL-9 [MH9A4] Human ELISA, FC
Anti-Lupin Allergen [X291] Lupinus ELISA
Anti-Lysozyme [cAb-Lys3] Chicken, hen, turkey ELISA
Anti-Lysozyme [D11.15] black-necked pheasant, Chicken, helmeted guineafowl, Japanese quail SPR, ELISA
Anti-Macadamia Allergen [X313] Macadamia nut ELISA
Anti-Pancreatic alpha-amylase [AMD9] Pig (Sus scrofa) ELISA
Anti-Peanut Allergen [X378] Arachis hypogaea ELISA
Anti-Phl p 1 [Clone 10] Timothy-Grass (Phleum pratense) WB
Anti-Phl p 1 [Clone 25] Timothy-Grass (Phleum pratense) dotblot, WB, ELISA
Anti-Phl p 1 [Clone 43] Timothy-Grass (Phleum pratense) WB
Anti-Phl p 1 [p1-20] Phleum pratense (common timothy) ELISA
Anti-Phl p 11 [p11-5] Phleum pratense (common timothy) ELISA
Anti-Phl p 2 [p2-2] Phleum pratense (common timothy) ELISA
Anti-Phl p 4 [p4-5] Phleum pratense (common timothy) ELISA
Anti-Phl p 5 [4.2] Timothy-Grass (Phleum pratense) ELISA
Anti-Phl p 5 [p5-11] Phleum pratense (common timothy) ELISA
Anti-Phl p 6 [p6-1] Phleum pratense (common timothy) ELISA
Anti-Soy Allergen [X259] Glycine max (Glycine hispida, Soybean) ELISA

Anti-Coronavirus Antibodies

Coronaviruses are a group of viruses at the source of several recent outbreaks, including SARS (Severe Acute Respiratory Syndrome) in 2003, MERS (Middle East Respiratory Syndrome) in 2012 and most recently the outbreak of COVID-19, the illness caused by the SARS-CoV-2 virus. Our collection of anti-coronavirus antibodies was largely obtained from B-cell sequencing of human patients. In addition to the original human IgG1 antibodies, recombinant antibody technology has enabled the production of various engineered formats designed to open up new experimental possibilities for in vitro and in vivo use.

This year, the anti-SARS clone CR3022 was shown to have high affinity for the then-termed 2019-nCoV. The clone is now available in our catalog in formats such as IgM, IgA, antibody fragments, and IgG in different species and isotypes.

The Absolute Antibody team is working hard to support coronavirus research and therapeutic development by supplying related reagents to customers worldwide, as well as providing antibody engineering and manufacturing services. We continue to add new reagents to our catalog, including recombinant anti-human immunoglobulin antibodies for COVID-19 diagnostics and ACE2 Fc fusion proteins.

Clone Name Available Formats Applications
Anti-Spike Protein [CV1] Human IgG1, IgM, IgA, IgA1, IgA2, IgG2, IgG3, Fab fragment and Fab 2; Mouse IgG1, IgM, Fab fragment and Fab2; Rabbit IgG; Cat IgG1 and IgM; Ferret IgG1, IgM and IgA NTRL, ELISA, FC, Therapeutic
Anti-Spike Protein (RBD) [CV30] Human IgG1, IgM, IgA, IgA1, IgA2, IgG2, IgG3, Fab fragment and Fab 2; Mouse IgG1, IgM, Fab fragment and Fab2; Rabbit IgG; Cat IgG1 and IgM; Ferret IgG1, IgM and IgA NTRL, ELISA, FC, Therapeutic
Anti-COVID-19 & SARS-CoV S glycoprotein [CR3022] Human IgG1, IgM, IgG3, IgA, IgA1, Fab, Fab2, IgG2, IgG4 and IgE; Mouse IgG2b, IgM, Fab fragment and Fab2; Rabbit IgG; Cat IgM and IgG1; Ferret IgG1, IgM and IgA NTRL, ELISA
Anti-Covid-19 & SARS-CoV Nucleoprotein [CR3018 (03-018)] Human IgG1, IgM, IgG3, IgA, IgA1, IgGA2, Fab, Fab2 and IgG2; Mouse IgG2b, IgM, Fab fragment and Fab2; Rabbit IgG; Cat IgM and IgG1; Ferret IgG1, IgM and IgA ELISA, IF
Anti-Covid-19 & SARS-CoV Nucleoprotein [CR3009 (03-009)] Human IgG1, IgM, IgG3, IgA, IgA1, IgA2, Fab, Fab2 and IgG2; Mouse IgG2b, IgM, Fab fragment and Fab2; Rabbit IgG; Cat IgM and IgG1; Ferret IgG1, IgM and IgA ELISA, IF
Anti-Spike protein (RBD) [Sb#14]] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH ELISA, Blocking
Anti-Spike protein (RBD) [Sb#15] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH ELISA, Blocking
Anti-Spike protein (RBD) [Sb#16] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH ELISA, Blocking
Anti-Spike protein (RBD) [Sb#42] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH ELISA, Blocking
Anti-Spike protein (RBD) [Sb#45] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH ELISA, Blocking
Anti-Spike protein (RBD) [Sb#68] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH ELISA, Blocking
Anti-SARS-CoV S glycoprotein [S227] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S230] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S215] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S109] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S124] Human IgG1, IgM, IgG3, IgA1, Fab fragment and Fab2; Mouse IgG2b; Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S222] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S231] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S228] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S226] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S217] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S223] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S110] Human IgG1, IgM, IgG3, IgA1, Fab fragment and Fab2; Mouse IgG2b; Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S225] Human IgG1, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [4G2] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [5D3] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [6B1] Human IgG, Human IgG2, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [5E4] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [1B5] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [4D4] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [11A] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [256] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA
Anti-SARS-CoV S glycoprotein [A11] Human IgG1, Human IgM, Mouse IgG, Mouse IgG2b, Mouse IgM, Rabbit IgG, scFv fragment ELISA, IF, WB
Anti-SARS-CoV S glycoprotein [F26G9] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA, IF
Anti-SARS-CoV S glycoprotein [F26G10] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA, IF
Anti-SARS-CoV S glycoprotein [F26G19] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL, ELISA, IF, WB
Anti-MERS-CoV Spike Protein [D12] Mouse IgG1, Rabbit IgG1 NTRL, ELISA, IF
Anti-MERS-CoV Spike Protein [4c2] Mouse IgG1, Rabbit IgG1 NTRL, ELISA
Anti-MERS-CoV Spike Protein [3B12] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL
Anti-MERS-CoV Spike Protein [M14D3] Human IgG1, Human IgM, Mouse IgG1, Mouse IgM, Mouse IgG2b, Rabbit IgG NTRL
Anti-MERS-CoV Spike Protein [1F8] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL
Anti-MERS-CoV Spike Protein [3A1] Human IgG, Human IgM, Mouse IgG, Mouse IgM, Rabbit IgG NTRL
Anti-Bovine coronavirus [SF-3E4] Mouse IgG1, Rabbit IgG1 NTRL, ELISA, WB
Anti-SARS-CoV-2 and SARS-CoV nucleocapsid [mBG17] Human IgG1, IgG2, IgG3, IgE, IgM, IgA1, Fab fragment and Fab2; Mouse IgG1, IgG2b, IgM, Fab fragment and Fab2; Rabbit IgG; Ferret IgG1, IgM and IgA; Cat IgG1 and IgM WB, ELISA, IF
Anti-SARS-CoV-2 nucleocapsid [mBG86] Human IgG1, IgG2, IgG3, IgM, IgA1, Fab fragment and Fab2; Mouse IgG1, IgA, IgM, IgG2b, Fab fragment and Fab2; Rabbit IgG; Ferret IgG1, IgM and IgA; Cat IgG1 and IgM WB, ELISA, IF
Anti-Spike protein [EY6A] Human IgG1, IgG2, IgA1, IgM, Fab fragment and Fab2; Mouse IgG2b and IgM; Rabbit IgG NTRL, Surface Plasmon Resonance, therapeutic, ELISA, IF
Anti-Spike protein [SR4] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH Biolayer interferometry, FACS, NTRL, therapeutic, ELISA
Anti-Spike protein [MR3] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH Biolayer interferometry, FACS, NTRL, therapeutic, ELISA
Anti-Spike protein [Sb23] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH Biolayer interferometry, NTRL, ELISA
Anti-Covid-19 & SARS-CoV Nucleocapsid [1C7C7] Human IgG1, IgM, IgA1, IgG2 and IgG4-S228P; Mouse IgG1, IgG2a, IgM, Fab fragment and Fab2; Rabbit IgG; Ferret IgG1, IgM and IgA; Cat IgG1 and IgM WB, ELISA, FC, IHC
Anti-Spike protein [Ty1] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH Biolayer interferometry, inhibit, NTRL, ELISA, FC, IF
Anti-Spike protein [MR17] Human IgG1, IgM, IgG3, and IgA; Mouse IgG1; Rabbit IgG; VHH Biolayer interferometry, FACS, NTRL, therapeutic, ELISA

Anti-Virus Antibodies

Absolute Antibody offers a range of recombinant antibodies against viral antigens. The antibodies were initially generated either through classic hybridoma technology, phage-display technology, or sequencing of (immortalized) B-cells from infected human patients. In particular we offer a range of antibodies generated by Humabs BioMed SA from real human patients using their Cellclone technology.

View Anti-Virus Antibodies Products

Antibodies to Epitope Tags

Our range of recombinant antibodies against epitope tags includes classic clones like 9E10 (anti c-myc) offered in multiple species and isotypes to suit your experiment.

 

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-Biotin [mAb2] Species independent ELISA
Anti-Biotin [mAb7] Species independent ELISA
Anti-Biotin [muM33] Species independent epitope tag, WB, ELISA
Anti-c-myc epitope tag [9E10] Human IHC-F, IHC-P, IP, WB, IF
Anti-CD56 [N901] Human IP, FC, IF
Anti-DDDDK-tag [M2.1] n/a WB, ELISA, IF
Anti-EE-tag [3D5/EE_48.K] EE tag WB, ELISA
Anti-Flag tag [2H8] Species independent IP, FC, IF, IHC
Anti-GCN4 [C11L34] S. cerevisiae IP, SPR, WB
Anti-GSTP1 [SAIC-22D-22] Human immunoMRM
Anti-HA Tag [16.43] Virus (Influenza) IP, WB, ELISA, FC, IF, IHC
Anti-His tag (C-term) [3D5] n/a WB, ELISA
Anti-IL-5 [JES1-39D10] Human immunocytochemistry, Block, ELISA, FC, IHC
Anti-MBP [MBP-7128] Escherichia coli ELISA
Anti-MBP [MCS2] Escherichia coli
Anti-MBP [sAb-11M] Escherichia coli ELISA
Anti-MBP [sAb-70] Escherichia coli ELISA
Anti-MBP [sAb-P1] Escherichia coli ELISA
Anti-Notch 1 [2E6] Human inhibit, Block
Anti-Podoplanin (MAP tag) [PMab-1] Mouse epitope tag, WB, Block, ELISA, IHC
Anti-Protein C [HPC-4] Baboons, Human Blocking, Purification, ELISA
Anti-RAP tag [PMab-2] Rat epitope tag, WB, ELISA, FC, IHC
Anti-Rhodopsin [Rho 1D4] Cow, Human, Zebrafish, Amphibians, Rat, Mouse IP, Radioimmune labeling, WB, ELISA, IF, IHC
Anti-Rim ABC protein [Rim 3F4] Cow, Xenopus laevis, Xenopus tropicalis, Human, Mouse IP, WB, ELISA, IF, IHC
Anti-Softag 1 [NT73] E.coli WB, ELISA
Anti-Strep-Tag II [C23.21] Streptomyces avidinii WB, ELISA
Anti-TK15 epitope tag [TK 15] Xenopus laevis IP, WB, IF
Anti-V5 epitope tag [SV5-P-K] Paramyxovirus Simian Virus 5 IP, RIA, WB, ELISA, IF, IHC-Fr

Murine Bispecific Antibody Reagents

Bispecific antibodies are an exciting class of therapeutics permitting simultaneous engagement of two distinct targets with the same antibody. Knob-into-hole (KIH) bispecific antibodies are playing an important role in drug development, as this pioneering format enables heavy-chain heterodimerization and the creation of an IgG-like antibody with different targets on each arm. However, researchers have lacked syngeneic mouse models for evaluating KIH bispecific combinations, as the mutations applied to human IgG1 cannot be readily transferred to murine IgG subtypes.

To address this, Absolute Antibody has developed the first commercially available platform for the generation of fully murine KIH bispecific antibodies. Customers can purchase bispecific antibodies from our catalog off-the-shelf, or mix-and-match targets from the catalog to build their own custom reagent, to enable easier evaluations of potential bispecific combinations in mouse models.

Highlights of our murine KIH bispecific antibodies include:

  • One IgG ‘arm’ uses a single-domain binder to overcome the light-chain pairing problem
  • Our proprietary Fc Silent™ domain abrogates Fc gamma receptor and C1q binding without affecting FcRn-mediated recycling
  • Fully murine backbone for low immunogenicity in mouse models
  • Low endotoxin levels and high purity for in vivo research
  • Our T-cell-engaging CD3ε-bispecific antibodies have demonstrated success
    killing tumor cells in mouse models

For more information, download our research poster to learn about the generation of our KIH bispecific antibody platform and review functional characterization of our anti-mCD3ε:TRP-1 bispecific antibody, capable of selectively recruiting T-cells to TRP-1+ cancer cells for increased cytotoxic effector function. You can also read a customer case study about researchers at the Leiden University Medical Center who used two of our bispecific antibodies in a study that showed oncolytic viruses in combination with CD3ε-bispecific antibodies could improve the immunotherapy treatment of solid cancer tumors.

In addition to our KIH bispecific antibodies, further murine bispecific antibody constructs are available in an IgG-dAb format, enabling bivalent engagement of each target and representing further antibody engineering options available to our customers. To learn more about our suggested initial go-to formats for bispecific antibodies, as well as the utility of mouse bispecifics in basic research and drug discovery.

View our off-the-shelf bispecific antibodies below, and follow the links to place your order. Please contact us to discuss creating a custom bispecific reagent, using either clones from our catalog or your own antibodies. Starting with a hybridoma cell line, purified antibody or antibody sequence, we can deliver milligram-to-gram quantities of your custom bispecific, 100% royalty-free.

Available Bispecific Antibodies:

 

Targets mCD3ε hCD3ε mPD-L1 mCD47 mOX40 mCD28
mCD19 mKIH
mCD20 mKIH
mCTLA-4 mKIH mIgG-dAb
hEGFR mKIH
hEGFRvIII mKIH
herbB-2 (Her-2/neu) [Trastuzumab] mKIH mKIH
F4/80 mKIH
Fluorescein mKIH mKIH mKIH
TRP-1 mKIH mKIH mKIH
mCD200 mIgG-dAb
mPD-1 mIgG-dAb mIgG-dAb
mPDL1 mKIH mIgG-dAb mIgG-dAb mKIH
mVISTA (PD-1H) mIgG-dAb
mTIGIT mIgG-dAb
mNKG2D mKIH

DNA/RNA Research Antibodies

DNA and RNA are often thought of as mere information storages; however, the ability of nucleotide sequences to fold into defined structures has allowed nature to exploit these as catalytic and regulatory elements as well.

As our understanding of DNA- and RNA-biology continues to grow, new research tools are required to help us understand the impact on diverse branches of research such as cancer, immunology, aging and infectious disease. At Absolute Antibody, we offer a variety of recombinant engineered antibodies targeting nucleotide structures, in particular DNA and/or RNA primary, secondary and tertiary structures.

Our DNA/RNA research collection includes antibodies for classic structures, including single- or double-stranded DNA, dsRNA, hairpin DNA and Z-DNA, as well as antibodies for more recently discovered structures such as DNA/RNA hybrids, G-quadruplexes and i-Motif. Moreover, we are also featuring our collection of antibodies against naturally occurring or chemically induced modified nucleotide bases. All antibodies are recombinantly produced for ensured purity and batch-to-batch reproducibility.

Each antibody clone is available in a variety of species, isotypes and subtypes designed to increase experimental flexibility and antibody compatibility. For example, you can select a format to enable easier co-labelling studies or increase compatibility with a secondary reagent. You can also add a custom conjugation to allow for easier detection, or select a monomeric binder such as a Fab fragment or half-antibody to improve localization in super-resolution methods and maintain single-domain binding characteristics.

 

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-(6-4) DNA photoproducts [64M-2] Species independent ELISA, IF
Anti-(6-4) DNA photoproducts [64M-5] Species independent ELISA, IF
Anti-5-Hydroxymethylcytosine [AB3/63.3] Species independent Dot, IP, IF
Anti-Cisplatin modified DNA [CP9/19] Species independent dotblot, IP, ELISA, IHC
Anti-DNA-RNA hybrid [S9.6] n/a ABA, CHIP, ChIP-seq, DB, EMSA, FISH, ICC, IP, SPR, IF
Anti-DNA/RNA G-quadruplex [BG4] Human EMSA, ELISA, IF
Anti-Hairpin DNA [DNA-1] WB, ELISA
Anti-i-motif DNA [iMab] n/a BLI, confocal microscopy, ELISA, IF
Anti-N6-methyladenosine [17-3-4-1] Saccharomyces cerevisiae, Human, Mouse immunoblot, IP
Anti-Quadruplex DNA [1H6] Species independent ELISA, IF, IHC
Anti-Quadruplex DNA [4E11] Species independent ELISA, IHC
Anti-Quadruplex DNA [5E11] Species independent ELISA, IHC
Anti-Quadruplex DNA [8H2] Species independent ELISA, IHC
Anti-single-stranded poly(rI) RNA [Jel 103] Species independent SPRIA, IF
Anti-ss/dsDNA [A52] Species independent crystallize, RIA, ELISA
Anti-ssDNA/dsDNA [m3D8] Species independent hydrolysis, SPR, ELISA
Anti-Triplex DNA [Jel 466] IF
Anti-Z-DNA [Z22] Species independent gel retardation assay, SPR, ELISA, IF

Recombinant F4/80 Clone CI:A3-1

Anti-F4/80 [Cl:A3-1] antibody is the most widely publicized and referenced mouse macrophage and microglia marker, making it a valuable tool for research.

At Absolute Antibody, we have sequenced the original hybridoma (rat anti-mouse F4/80 clone Cl:A3-1; Gordon and Austyn, 1981) and produced recombinant and chimeric anti-F4/80 clone Cl:A3-1 versions, allowing greater experimental flexibility and control for the end user (See Why Go Recombinant?).

  • We are the ONLY commercial manufacturer of recombinant F4/80 [Cl:A3-1] monoclonal antibody.
  • We are the ONLY commercial manufacturer of recombinant chimeric mouse anti-mouse F4/80 [CI:A3-1] monoclonal antibody, allowing experimental flexibility never allowed before.
  • We are the ONLY commercial manufacturer who offers recombinant rat anti-mouse and chimeric mouse anti-mouse F4/80 Clone CI:A3-1 antibodies with an effector-silent Fc domain (Fc SilentTM), allowing greater versatility and confidence for in vivo and in vitro applications.
  • Our proprietary AbAb recombinant platform allows us to manufacture chimeric versions of the F4/80 [Cl:A3-1] antibody, allowing you to ‘species switch‘ the antibody’s Fc domain (i.e., change the species of the Fc domain to rat, mouse, human, etc.), while still retaining the antibody’s original species and antigen specificity and sensitivity.
  • We offer mouse, rat, human, and hamster un-engineered (wild-type) Fc and Fc SilentTM domains.

F4/80 is a mature mouse cell surface glycoprotein and is a member of the epidermal growth factor (EGF)-transmembrane 7 (TM7) family. High level of expression is found on most tissue macrophages including the spleen, liver kupffer cells, microglia in the brain and skin Langerhans cells.

Absolute Antibody recombinant mouse anti-mouse and rat anti-mouse F4/80 Clone Cl:A3-1 are supplied in purified, azide-free, and low endotoxin versions to allow for in vivo applications.

If you cannot find F4/80 in the format you are looking for or would like to obtain a quote for bulk orders, please just get in touch.

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-F4/80 [Cl:A3-1 (recombinant version)] Mouse FC, IHC

Recombinant Isotype Controls

Negative controls are essential to conducting thorough and meaningful experiments. Antibodies can bind to other molecules, especially other proteins, in non-specific or undesired ways. To show that identification of a particular band on a Western Blot or staining for a cell-surface marker in flow cytometry using an antibody is specific, a negative control may be used which should not result in similar band patterns or staining.

Isotype Controls

Isotype controls are a particular type of negative control that feature the same Fc region as the antibody the actual experiment is being conducted with but a variable region that should not bind antigen in the experiment. The Fc region can interact specifically with Fc receptors or complement; hence, it is necessary to control for this “background” when staining for cell-surface markers. These interactions may even be across species; e.g., rat IgG with mouse Fc receptors. Therefore, a diverse panel of isotype controls was traditionally required when performing flow cytometry. See also our Fc Silent™ product range for practical solutions to this problem.

Standardized Controls Offered by Absolute Antibody

Antibody engineering makes possible the generation of a standardized panel of isotype controls with the same “specificity” (i.e., derived from the same original antibody) – this can reduce experimental complexity. The panels benefit from the superior reproducibility and purity we obtain using our recombinant production platform.

Absolute Antibody currently offers isotype-control panels derived from four different antibodies: anti-NP, anti-fluorescein, anti-beta galactosidase (from E. coli) and an antibody called MOPC-21 with unknown specificity. All are available in human, mouse, rat, rabbit and hamster isotypes.

Don’t see the format you need? Just contact us and we’ll be happy to help you.

 

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-Beta-galactosidase [13R4] E. coli negative control, WB, FC
Anti-Beta-galactosidase [GL117] E. coli ELISA
Anti-Fluorescein [4-4-20 (enhanced)] n/a negative control
Anti-hapten 4-hydroxy-3-nitrophenyl acetyl (NP) [B1-8] n/a negative control
Anti-Unknown Specificity (Isotype control) [MOPC-21] n/a negative control

Tumor Marker Antigens

Tumor antigens serve as important tumor markers and can be used as targets in the detection and treatment of cancer. Antibodies targeting these tumor markers may have diagnostic applications in detection of the presence, type and stage of cancer. They also form an important class of therapeutic antibodies.

Absolute Antibody offers a large catalog of 75+ tumor marker antigens, including anti-TAA (tumor associated antigens) and anti-TSA (tumor specific antigens). We have used our recombinant antibody technology and antibody engineering to generate different engineered formats of these antibodies for all your experimental needs.

Highlights of our tumor marker antigens include:

  • Engineer antibodies into any species and with any effector function
  • Fc Silent™ formats help to eliminate antibody directed cytotoxicity (ADCC) effector function of Fc receptors
  • Create bispecific antibodies on human or mouse background
  • Recombinantly produced to ensure batch-to-batch reproducibility
  • Low endotoxin levels and high purity for in vivo and in vitro research

View all of our off-the-shelf tumor marker antigens below and follow the links to place your order. If you would like to discuss creating a custom engineered antibody, please contact us. We are always happy to engineer our antibodies to fit your research needs. As we say – If you can describe it, we can make it.

 

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-A33 [huA33] Human deplete, ELISA, IF, IHC
Anti-Alpha-fetoprotein (AFP) [AF5] Human WB, FC, IF
Anti-Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 [32C8_71] Human DSF, SPR, ELISA
Anti-Aspartate beta-hydroxylase [G3-F11] Human WB, ELISA, IHC
Anti-BCL2 [bcl-2/100] Human IP, WB, IHC
Anti-Beta-2 microglobulin [BBM.1] Human Depletion, WB, IF, IHC
Anti-BLC2 [bcl-2/124] Human IP, WB, IHC
Anti-Breast Epithelial Mucin [BrE-3] Human ELISA
Anti-c-erbB-2 [FWP51] Human fusion, IP, FC, IF
Anti-CA125 [196-14] Human ELISA, IHC
Anti-CA125 [OC125-3.11] Human IP, WB, ELISA, FC, IF, IHC
Anti-CA125 [VK-8-1.9] Human IP, WB, ELISA, FC, IF, IHC
Anti-CA19-9 [4A6] Human ELISA
Anti-CA19-9 [4G2] Human ELISA
Anti-CA242 [C242] Human IHC
Anti-CA242 [WT 1-31] Human ELISA
Anti-CA50 [CA50Ab01] Human ELISA, IF
Anti-Canine Lymphoma [Mab231] Dog, Human RIA, FC
Anti-carcinoembryonic antigen (CEA) [Arcitumomab] Human IHC-P, FC, Imaging
Anti-carcinoembryonic antigen [A5B7] Human radiolabelling, therapeutic, IHC
Anti-CD155 [CD155.16 ] Human FC
Anti-CD155 [scFv1] Human IP, FC
Anti-CD155 [scFv3] Human functional assay
Anti-CD155 [SKII.4] Human ICC, IP, ELISA, FC, IF, IHC
Anti-CD19 [B4] Human FC, IF, IHC
Anti-CEA [BW431/26] Human Immunoscintigraphy
Anti-CEA [CH1A1A (2F1, CH1A1A-2F1)] Human ELISA, FC, IHC
Anti-CEA [EB-011] Human ELISA
Anti-CEA [EB-022] Human ELISA
Anti-CEA [T84.66] Human Immunoscintigraphy, immunotherapy, RIA, ELISA, FC, IHC
Anti-CIP2A [HL1925] Human IHC (P), WB
Anti-CSAp [Mu-9] Human therapeutic, ELISA, IHC
Anti-Ctip2 [25B6] Guinea Pig, Rat, Zebrafish, Human, Cynomolgus Monkey, Mouse CHIP, IHC-P, IP, WB, FC, IF, IHC-Fr
Anti-Cytokeratin 7 [OV-TL 12/30] Human WB, FC, IF, IHC
Anti-Cytokeratin 8 [TS1] Human IP, radioimmunotherapy, WB, ELISA, IHC
Anti-deltaEGFR [DH8.3] Human IP, WB, ELISA, FC, IHC
Anti-EGFR [2F8 (Zalutumumab; HuMax-EGFR)] Human WB, ELISA, FC
Anti-EGFR [2224] Human FC
Anti-EGFR [528] Human IHC-P, IP, NTRL, WB, FC, IF
Anti-EGFR [C225 (Cetuximab)] Human Block, FC
Anti-EGFR [cet.Hum (Cetuximab – humanized; hC225)] Human WB, Block, ELISA, FC
Anti-EGFR [EGFR1] Human IP, WB, FC, IF, IHC
Anti-EGFR [L2 1C] Human WB, ELISA, FC
Anti-EGFR [L3 11D] Human SDS-PAGE, WB, ELISA, FC
Anti-EGFR [Matuzumab] Human antagonist, WB, Block, ELISA, FC, IF
Anti-EGFR [S3 12D] Human ICC, WB, ELISA, IF, IHC
Anti-EGFR [S4 10H] Human WB, ELISA, FC
Anti-EGFR domain III [h-R3 (Nimotuzumab)] Human Block, FC, IHC
Anti-EGFRvIII [L8A4] Human Biacore, WB, ELISA, FC, IF, IHC
Anti-Endosialin [scFv78]
Human, Mouse
 tumor imaging, ELISA, FC
Anti-EPCAM [B38.1] Human RIA, ELISA
Anti-erbB-2 (Her-2/neu) [4D5-8 (trastuzumab)] Human ELISA, FC, IHC
Anti-ERBB2 [SAIC-02A-7] Human immunoMRM, WB, ELISA
Anti-GA733-2 [FU-MK-1]
n/a
 IB, ICC, WB, ELISA, IHC
Anti-GDF15 [Clone 29] Human functional assay, inhibit, WB, ELISA
Anti-GDF15 [MBM-12] Human functional assay, inhibit, ELISA
Anti-GDF15 [MBM-14] Human functional assay, inhibit, ELISA
Anti-Glypican-1 [AbAb-GPC1] Human ELISA, FC
Anti-Glypican-1 [AbAb2-GPC1] Human ELISA
Anti-HER2 [4D5] Human crystallization, in vivo, inibition, IP, therapeutic, FC
Anti-HER2 [C7b] Human cytometric bead array, WB, ELISA, FC, IHC
Anti-HER2 [ML3-9 (C6ML3-9)] Human RIA, SPR, FC
Anti-HER2/neu [SER4] Human ELISA
Anti-HER3 [A5 ] Human SPR, FC
Anti-HER4 [B6 (HER4.B6)] Human ELISA
Anti-high MWT epithelial antigens [KC4G3] Human WB, IHC
Anti-Human Ephrin Type A receptor 2 [1C1] Human agonist, internalizing, WB, ELISA, FC, IF
Anti-JAM-A [6F4] Human WB, ELISA, FC, IF, IHC
Anti-KRAS G12C mutant [AbAbKRAS01] Human WB, ELISA
Anti-KRAS G12D mutant [D113] Human ELISA
Anti-Lewis Y [3S193] Human humanisation, ELISA, IHC
Anti-LeY [BR96] Human ELISA, IHC
Anti-LeY [H18A] Human ELISA, IHC
Anti-LMP1 [H3]
Epstein-Barr virus (EBV)
 inhibit, IP, ELISA, IF
Anti-m5C [FMC-9]
Species independent
 ICC, IPP, WB, ELISA, IHC
Anti-MAGEA3 [21B4] Human IP, WB, ELISA, FC, IHC
Anti-Mesothelin [11-25] Human IP, ELISA, FC
Anti-Mesothelin [C10] Human SPR, ELISA, IHC
Anti-Mesothelin [IC14-30] Human ELISA
Anti-Mesothelin [K1]
Cynomologous monkey, Human
 RIA, SPR, WB, ELISA, IF, IHC
Anti-MPF [20-10] Human IP, WB, ELISA
Anti-MPF [41-28] Human IP, WB, ELISA
Anti-MUC1 [E29] Human WB, IHC
Anti-MUC1 [HMFG1 (1.10.F3)] Human ICC, IP, ELISA, FC, IF, IHC
Anti-MUC1 [HMFG2] Human ELISA, IHC, Imaging
Anti-MUC1 [Mc5] Human IP, IRA, WB, ELISA, IHC
Anti-MUC1 [PAM4] Human therapeutic, WB, ELISA, FC, IHC
Anti-MUC1 [SM3] Human ELISA; IHC-P, FC, IHC-Fr
Anti-NSE [E1-7E2] Human WB, ELISA
Anti-NSE [E2-4F6] Human WB, ELISA
Anti-A33 [huA33]
 Human deplete, ELISA, IF, IHC
Anti-Alpha-fetoprotein (AFP) [AF5]
 Dog, Human WB, FC, IF
Anti-Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 [32C8_71]
 Dog, Human DSF, SPR, ELISA
Anti-Aspartate beta-hydroxylase [G3-F11]
 Human, Mouse WB, ELISA, IHC
Anti-BCL2 [bcl-2/100]
 Human IP, WB, IHC
Anti-Beta-2 microglobulin [BBM.1]
 Human Depletion, WB, IF, IHC
Anti-BLC2 [bcl-2/124]
 Monkey, Rabbit, Rat, Human, Mouse IP, WB, IHC
Anti-Breast Epithelial Mucin [BrE-3]
 Human ELISA
Anti-c-erbB-2 [FWP51]
 Human fusion, IP, FC, IF
Anti-CA125 [196-14]
 Human ELISA, IHC
Anti-CA125 [OC125-3.11]
 Human IP, WB, ELISA, FC, IF, IHC
Anti-CA125 [VK-8-1.9]
 Human IP, WB, ELISA, FC, IF, IHC
Anti-CA19-9 [4A6]
 Human ELISA
Anti-CA19-9 [4G2]
 Human ELISA
Anti-CA242 [C242]
 Human IHC
Anti-CA242 [WT 1-31]
 Human ELISA
Anti-CA50 [CA50Ab01]
 Human ELISA, IF
Anti-Canine Lymphoma [Mab231]
Dog, Human
 RIA, FC
Anti-carcinoembryonic antigen (CEA) [Arcitumomab]
 Human IHC-P, FC, Imaging
Anti-carcinoembryonic antigen [A5B7]
 Human radiolabelling, therapeutic, IHC
Anti-CD155 [CD155.16 ]
 Human FC
Anti-CD155 [scFv1]
 Human IP, FC
Anti-CD155 [scFv3]
 Human functional assay
Anti-CD155 [SKII.4]
 Human ICC, IP, ELISA, FC, IF, IHC
Anti-CD19 [B4]
 Human FC, IF, IHC
Anti-CEA [BW431/26]
 Human Immunoscintigraphy
Anti-CEA [CH1A1A (2F1, CH1A1A-2F1)]
 Human ELISA, FC, IHC
Anti-CEA [EB-011]
 Human ELISA
Anti-CEA [EB-022]
 Human ELISA
Anti-CEA [T84.66]
 Human Immunoscintigraphy, immunotherapy, RIA, ELISA, FC, IHC
Anti-OA3 [OV-TL3] Human IB, WB, Block, ELISA, IF, IHC
Anti-osteosarcoma-associated cell membrane antigen [TP-1]
Dog, Human
 radioimmunodetection, IF, IHC
Anti-osteosarcoma-associated cell membrane antigen [TP-3]
Dog, Human
 radioimmunodetection, IF, IHC
Anti-p21 [Y13-238]
Human, Mouse
 IP;
Anti-p21Ras [DWP] Human WB, ELISA, IHC
Anti-p21Ras [KGH-R1] Human ICC, IHC-FFPE, WB, ELISA, IF
Anti-p53 [PAb421]
Monkey, Rabbit, Rat, Human, Mouse
 IHC -P, in vivo, IP, WB, ELISA, IF, IHC-Fr
Anti-polymorphic epithelial mucin [CTM01] Human IP, therapeutic, IHC
Anti-PSA [8G8F5] Human ELISA
Anti-PSA [scFv B8] Human SPR, WB
Anti-PSMA [11d1e5E10] Human ELISA, IHC
Anti-PSMA [J591] Human IP, therapeutic, WB, ELISA, FC, IF, IHC
Anti-S100 [S1-61] Human WB, IHC
Anti-S100B [1C8] Human therapeutic, ELISA
Anti-Synaptophysin [SP15]
Cat, Hamster, Pig, Rat, Human
 WB, ELISA, IHC
Anti-TAG-72 [Minretumomab (CC49 )] Human RIA, therapeutic, WB, FC, IHC
Anti-Tenascin [I-81C6 (Neuradiab)] Human cross-competition assay, immunoreactivity, radioiodination, ELISA
Anti-Tn Antigen [237mAb]
Human, Mouse
 WB, ELISA
Anti-trastuzumab (anti-idiotype) [scFv40] Human immunogen, Block
Anti-trastuzumab (anti-idiotype) [scFv69] Human immunogen, Block
Anti-TRP-1, gp75 [TA99] Human IP, WB, ELISA, FC, IF, IHC-Fr
Anti-Tumor associated glycoprotein (TAG) 72 [B72.3 (Satumomab)] Human FC, IHC, Imaging
Anti-VAP-1 [2D10] Human IP, WB, ELISA, FC, IHC
Anti-VAP-1 [3F10] Human ELISA, IHC
Anti-VAP-1 [3G6] Human ELISA, IHC
Anti-VAP-1 [TK8-14] Human IP, WB, ELISA, FC, IHC

Recombinant Antibodies from Human Patients

Human antibodies from patients are being sequenced at an increasing rate – see Quake et al. for an up-to-date review of high-throughput sequencing of antibodies. Amongst others, we are excited to offer you a range of human-derived antibodies specific to viral pathogens or self-antigen (many in collaboration with Humabs BioMed SA, Bellinzona, Switzerland). Our proprietary cloning platform allows us to produce high-quality recombinant versions of these antibodies – we think some will be valuable reagents for research and diagnostics. We offer the original human IgG version as well as reformatted mouse and rabbit versions to suit your experimental requirements- contact us for bulk custom orders.

Adjacent figure shows: Indirect immunofluorescence (IF) staining of live keratinocyte monolayers with pemphigus vulgaris (PV) auto-antibodies
(A) Cryosections of human skin stained with biotinylated DSG3-specific monoclonal antibodies (Ab00153, Ab00155, Ab00158 and Ab00156).
(B) Binding of a panel of pemphigus auto-antibodies to DSG3-coated ELISA plates in the presence or absence of EDTA. Antibodies described in (external links): Corti D et al. 2010 as well as Di Zenzo G et al. 2012.
(C) Staining of human epidermis with biotinylated PVB28 (Ab00158) in the presence (with) or absence (w/o) of Ca2+

 

Antibody Name [Clone] Expected Species Reactivity Applications
Anti-desmoglein-3 [PVA218] Human ELISA, IF
Anti-desmoglein-3 [PVA232] Human ELISA, IF
Anti-desmoglein-3 [PVB124] Human ELISA, IF
Anti-desmoglein-3 [PVB16] Human ELISA, IF
Anti-desmoglein-3 [PVB28] Human ELISA, IF
Anti-desmoglein-3 and desmoglein-1 [PVA224] Human ELISA, IF
Anti-desmoglein-3 and desmoglein-1 [PVA3] Human ELISA, IF
Anti-DI/DII domain of Dengue E protein [DV18] Dengue Virus NTRL, ELISA
Anti-DI/DII domain of Dengue E protein [DV78] Dengue Virus NTRL, ELISA
Anti-DIII domain of Dengue E protein (DENV-1 and DENV-3) [DV63] Dengue Virus NTRL, ELISA
Anti-DIII domain of Dengue E protein [DV10] Dengue Virus NTRL, ELISA
Anti-Ebola Nucleoprotein [KZ51] Ebola Virus (Zaire, Ivory Coast, Reston, Sudan) IP, WB, ELISA, IF
Anti-Ebola surface glycoprotein [KZ52] Ebola (Zaire) crystallization, IP, NTRL, IF
Anti-GM-CSF [GCA43] Human Biacore, NTRL, ELISA
Anti-GM-CSF [GCC21] Human Biacore, NTRL, ELISA
Anti-HA [FB75] Influenza A Virus (several subtypes) NTRL, ELISA
Anti-HA [FC41] Influenza A Virus (several subtypes) ELISA
Anti-HA [FE17] Influenza A Virus (several subtypes) ELISA
Anti-HIV-1 GP120 [HGD65] HIV-1 NTRL
Anti-HIV-1 GP120 [HGN194] HIV-1 NTRL
Anti-HIV-1 GP120 [HGZ1] HIV-1 NTRL
Anti-HIV-1 GP120 [HJ16] HIV-1 NTRL
Anti-HIV-1 GP120 [HR10] HIV-1 NTRL
Anti-HIV-1 GP120 [HR12] HIV-1 NTRL
Anti-HIV-1 GP41 [HGF24] HIV-1 NTRL
Anti-HIV-1 GP41 [HK20] HIV-1 NTRL
Anti-Influenza A HA [FLD127] H5N1 Influenza A Virus NTRL, RIA, ELISA
Anti-Influenza A HA [FLD20] H5N1 Influenza A Virus NTRL
Anti-Influenza A HA [FLD21] H5N1 Influenza A Virus NTRL
Anti-Influenza A HA [FLD84] H5N1 Influenza A Virus NTRL, RIA, ELISA
Anti-Influenza A HA [FLD93] H5N1 Influenza A Virus NTRL
Anti-Influenza A HA [HA] Influenza A Virus (several subtypes) ELISA
Anti-Norovirus GII.4 [NVB43.9] Norovirus NTRL, Block
Anti-pre- and post-fusion conformation of HRSV F protein [RSB15] Respiratory Syncytial Virus (RSV) NTRL, IF
Anti-pre- and post-fusion conformation of HRSV F protein [RSB16] Respiratory Syncytial Virus (RSV) NTRL, IF
Anti-pre-fusion conformation of HRSV F protein [RSB20] Respiratory Syncytial Virus (RSV) NTRL, IF
Anti-pre-fusion conformation of HRSV F protein [RSB43] Respiratory Syncytial Virus (RSV) NTRL, IF
Anti-Rh(D) [FOG-1] Human ELISA
Anti-SARS-CoV S glycoprotein [S109] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S110] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S124] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S215] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S217] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S222] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S223] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S225] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S226] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S227] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S228] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S230] SARS Coronavirus NTRL, ELISA
Anti-SARS-CoV S glycoprotein [S231] SARS Coronavirus NTRL, ELISA

Immunotherapy Research Antibodies

Antibodies against proteins involved in co-stimulation and other aspects of immune cell regulation are of particular interest to therapeutics developers. Some have already entered the clinic, with more in the development pipeline. However, many aspects of immune cell signaling are still unknown, and researchers require ever more advanced tools to tap into this potential. Absolute Antibody has developed a collection of recombinant engineered antibodies against clinically relevant proteins, including mouse homologues of current therapeutic targets.

  • Your favorite research tools, now updated through antibody engineering for improved performance in vivo
  • Reduce immunogenicity by matching antibody species to your host organism
  • Tailor effector function by choosing from our range of antibody isotypes and subtypes
  • Explore new possibilities by combining two of these antibodies into a custom bispecific reagent

 

Contact us if you have any questions or would like a quote.

See also: Our Fc fusion proteins are matched to our collection of immunotherapy antibodies, with all products available in a range of species-specific and engineered Fc domains.

Engineered Mouse-Anti-Mouse Antibodies

 

Catalog ID Mouse Target Antibody Clone Original Antibody Format
Ab01052 4-1BB (CD137) LOB12.3 Rat IgG1
Ab01054 4-1BBL (CD137L) AT113-2 Rat IgG1
Ab00881 4-1BBL (CD137L) TKS-1 Rat IgG2a
Ab01027 BTLA HMBT-6B2 Hamster IgG
Ab00670 CD27 LG.3A10 Hamster IgG
Ab00895 CD27 RM27-3E5 Rat IgG2a
Ab00286 CD28 E18 Mouse IgG2b
Ab00285 CD28 D665 Mouse IgG1
Ab01109 CD40 3/23 Rat IgG2a
Ab01087 CD40L (CD154) MR1 Hamster IgG
Ab00816 CD70 TAN 1-7 Rat IgG2a
Ab01056 CD70 TAN1-6 Rat IgG2a
Ab01028 CD80 (B7-1) RM80 Rat IgG2a
Ab01029 CD86 (B7-2) PO.3 Rat IgG2b
Ab01089 CD153 RM153 Rat IgG2b
Ab01297 CD96 6A6 Rat IgG2a
Ab00894 CTLA-4 9H10 Hamster IgG2
Ab01018 CTLA-4 9D9 Mouse IgG2b
Ab01088 GAL-9 RG9-35 Rat IgG2a
Ab01060 GITR DTA-1 Rat IgG2a
Ab00374 GITR YGITR 860.103.5 Rat IgG2b
Ab00631 GITR YGITR765 Rat IgG2b
Ab00630 GITRL YGL386 Rat IgG1
Ab01026 HVEM HMHV-1B18 Hamster IgG
Ab00814 ICOS 7E.17G9 Rat IgG2b
Ab00882 ICOSL HK5.3 Rat IgG2a
Ab01295 LAG3 C9B7W Rat IgG1
Ab01295 LAG3 C9B7W Rat IgG1
Ab00110 OX40 (CD134) OX86 Rat IgG1
Ab00564 OX40L OX-89 Rat IgG1
Ab00813 PD-1 RMP1-14 Rat IgG2a
Ab01017 PD-1H (VISTA) mam82 Mouse IgG1
Ab01016 PD-1H (VISTA) MH5A Hamster IgG
Ab00373 PD-L1 YDC 127.1.1 Rat IgG2a
Ab00883 PD-L2 TY25 Rat IgG2a
Ab00875 PDPN (MAP-Tag) PMab-1 Rat IgG2a
Ab00973 TIGIT 4D4 Hamster IgG
Ab01258 TIGIT 1B4 Mouse IgG1
Ab01032 TIM-1 3B3 Rat IgG2a
Ab01110 TIM-2 RMT2-14 Rat IgG2a
Ab01057 TIM-3 2C12 Rat IgG1
Ab01058 TIM-4 5G3 Rat IgG1
Ab01059 TIM-4 3A1 Rat IgG1

Research-Grade Biosimilars

Our research-grade biosimilars are research tools for the study and evaluation of biological processes without the need to source and purchase costly therapeutic-grade biologics. Free of excipients and/or additives found in the therapeutic formulations, our biosimilars require fewer extra controls in an experimental setting. In addition to the original human format, our biosimilars are available with mouse, rabbit, rhesus monkey and cynomolgus monkey constant domains.

Absolute Antibody research-grade biosimilars can be used as controls:

  • To benchmark novel biotherapeutics (biologics) for pre-clinical lead identification.
  • For the development of potency assays.

The growing range of research-grade biosimilars available from Absolute Antibody includes Trastuzumab, Muromonab, Campath-1H, Rituximab, Infliximab, Daclizumab, Basiliximab, Cetuximab, Satumomab, Acritumomab, Abaciximab, Eculizumab, Efalizumab, Clenoliximab, Ruplizumab, Matuzumab, Humicade, Volociximab and our most recent addition Oxelumab.

Can’t see what you were looking for? We can custom make any biosimilar of your choice – just send us the sequence. Contact us here.

Product Information

  • All research-grade biosimilars are supplied in PBS buffer with preservative (0.02% Proclin 300)
  • Endotoxin is < 1.0 EU/mg as determined by the LAL method
  • Purity is > 96% as determined by SDS-PAGE
  • Our research-grade biosimilars are NOT FOR THERAPEUTIC USE

For further information, to request any antibody in a different format, or for bulk orders please contact us and we’ll be happy to help you.

VivopureX™ Antibodies for In Vivo Research

VivopureX™ antibodies are recombinant mouse antibodies ideal for in vivo research in mouse models. The collection consists of popular antibody clones, many originally obtained from rats or hamsters, which Absolute Antibody has engineered into mouse-anti-mouse recombinant versions to improve research results. These species-matched chimeric antibodies consist of a clone’s original antigen-binding variable domain with a mouse constant domain.

VivopureX™ Recombinant Antibodies for In-Vivo Research

Our VivopureX™ recombinant mouse antibodies offer many advantages compared to the original antibody format, including:

  • Reduced immunogenicity: no neutralizing antibodies are induced in the host organism, meaning the antibody works for longer and cohorts respond more consistently.
  • Tailored effector function: antibody formats have been engineered to suit their most popular application. (Increased Fc receptor binding increases depleting potential, while reduced Fc receptor binding reduces side effects in blocking.)
  • Increased potency: less antibody is required to achieve the same response in mouse models.
  • Batch-to-batch reproducibility: recombinant production ensures the highest possible reproducibility, and guarantees high purity and low endotoxins (<0.5 EU/mg).

Mean tumor sizes in animals treated with PD-1 mouse IgG2a Fc Silent™ antibody based on clone RMP1-14 (Ab00813-2.3) are significantly smaller than in animals treated with the traditional rat IgG2a antibody (Ab00813-7.1)

Our data illustrate how VivopureX™ mouse antibodies provide increased long-term efficacy, potency and consistency compared to the original rat antibodies. In the figure to the left, our recombinant mouse PD-1 antibody based on the widely used clone RMP1-14 reduced tumor size in a mouse model more effectively than the original rat version.

Looking for another example? One of our customers used a species-matched mouse-anti-mouse antibody to deplete CD8+ T-cells in mice more completely and for longer than the original rat antibody.

The VivopureX™ antibody collection includes a selection of our most exciting mouse-anti-mouse antibodies, now available at competitively priced bulk prices. All are available in discounted bulk sizes ranging from 1 mg to 100 mg, as well as our standard 200 µg size. In addition, we offer our recombinant isotype controls at up to 50% discount if purchased together with a linked VivopureX™ antibody. Contact us to receive a quote.

We’ll continue to add new antibodies to the list below, so check back for updates! Contact us with questions, to receive a quote, or to ask if another antibody could be made available in a mouse-anti-mouse format in bulk for in vivo research.

 

Antibody Name [Clone] Engineered Format Top Application Available Bulk Sizes
Anti-OX40/CD134 [OX86] Mouse IgG1 Agonism 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-OX40/CD134 [OX86] Mouse IgG2a Agonism 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-PD-1 [RMP1-14] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CTLA-4 [9D9] Mouse IgG2a Blocking, Treg depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CTLA-4 [9D9] Mouse IgG2a Fc Silent™ Blocking, peripheral Treg expansion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-GITR [DTA-1] Mouse IgG2a Agonism 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD25 [PC-61.5.3] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-TIGIT [1B4] Mouse IgG1 Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-TIGIT [1B4] Mouse IgG2a Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Lag3 [C9B7W] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD96 [6A6] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-IL-10R [1B1.3a] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-BTLA [HMBT-6B2] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Tim-4 [3A1] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Tim-4 [5G3] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-TIM-2 [RMT2-14] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Tim-1 [3B3] Mouse IgG1 Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Tim-3 [2C12] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD115/M-CSFR [AFS98] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-PD-L1 [10F.9G2] Mouse IgG2b Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-PD-L1 [10F.9G2] Mouse IgG2b Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-IFN-gamma receptor 1 [GR20] Mouse IgG2b Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD20 [18B12] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD4 epitope A [YTS 177.9] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD4 epitope A [YTS 191.1] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD8 alpha/Lyt-2 [YTS 169.4] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Ly6G [1A8] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD200R [OX131] Mouse IgG1 Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-PD-L2 [TY25] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Ly6G/Ly6C [RB6-8C5] Mouse IgG2a Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-Galectin 9 [RG9-35] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD153 [RM153] Mouse IgG2a Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD153 [RM153] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD155 [3F1] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD226 [10E5] Mouse IgG2a Fc Silent™ Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD45R [RA3-6B2] Mouse IgG2a Depletion 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD19 [6D5] Mouse IgG2a Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-HVEM [HMHV-1B18] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD27 [RM27-3E5] Mouse IgG1 Agonism 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD22 [OX-97] Mouse IgG2a Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD47 [mIAP301] Mouse IgG2b Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Anti-CD80 [RM80] Mouse IgG2b Fc Silent™ Blocking 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg

Other Products

Engineered recombinant antibodies for a variety of research areas and applications.

View Other Products

Secondary Antibodies

Anti-Human Immunoglobulin Antibodies

Anti-immunoglobulin antibodies are important reagents used in the detection of antibodies. This may be in the form of a secondary antibody used to detect a primary antibody in methods such as western blot, immunohistochemistry, and immunofluorescence staining for microscopy or flow cytometry. Moreover, anti-immunoglobulin antibodies are important components of diagnostic tests. For example, they may be used in the characterization of immune responses or as control capture lines on lateral flow immunoassays.

Recombinant antibody technology allows you to obtain highly reliable anti-immunoglobulin antibodies tailored to your specific assay. Recombinant production provides the highest possible batch-to-batch reproducibility, while antibody engineering can be used to increase antibody compatibility with other assay components and extend antibody utility beyond the original format. Moreover, all our antibodies are manufactured in a completely animal- and animal-component free production platform.

We are pleased to announce our panel of recombinant anti-human immunoglobulin antibodies. The panel includes antibodies for human IgG, IgM, IgE and IgD, as well as anti-human kappa and lambda light chain antibodies for detection of all human antibodies. Available formats include human, mouse, rabbit and goat backbones, as well as antibody fragments, with other formats available upon request.

The panel is already proving popular among researchers fighting the current coronavirus pandemic, in light of the need for improved serological testing. These antibodies can be used to test for anti-SARS-CoV-2 antibodies in COVID-19 diagnostic tests

View our collection below, and contact us with any questions, to obtain an order quote, or to request pricing for bulk amounts.

 

Antibody Name [Clone] Species Reactivity Catalog Number
Anti-IgG [17F12] Human Ab01176
Anti-IgG [8E11] Human, chimpanzee, mangabey, vervet Ab01270
Anti-IgG [8F1] Human, non-human primates Ab01271
Anti-IgG [NH3/130.5.2] Human Ab00854
Anti-IgG3 [NH3/15.8] Human Ab00856
Anti-IgM [M15/8] Human Ab00292
Anti-IgE [huMaE11 (Omalizumab)] Human Ab00717
Anti-IgE [TES-C21] Human Ab00497
Anti-IgD [IgD26] Human Ab01328
Anti-Lambda light chain [N10/2] Human Ab01326
Anti-Kappa light chain [NH3/41.34] Human Ab00855
Anti-IgA [H15A43] Human Ab02044
Anti-IgM [B481] Human Ab02047
Anti-human immunoglobulin [X1237M] Human Ab02048

Anti-Non-Human Primate (NHP) Immunoglobulin Antibodies

Non-human-primate (NHP) models are important in preclinical research and are used as proxies for human immune responses. To help researchers investigate these, we offer a panel of recombinant anti-NHP immunoglobulin antibodies. This panel includes antibodies against key antibody isotypes and subtypes in widely used NHP models, such as rhesus macaque, cynomolgus monkey and baboon.

Anti-immunoglobulin antibodies are important reagents used in the detection of antibodies. Our NHP immunoglobulin antibodies can be used as secondary antibodies to detect primary antibodies in methods such as western blot, immunohistochemistry, and immunofluorescence staining for microscopy or flow cytometry. In addition, anti-immunoglobulin antibodies are important components of assays evaluating immune responses during cancer and autoimmunity drug development, infectious disease studies, and vaccine trials. Most recently, anti-immunoglobulin antibodies are finding extensive application in the study of COVID-19, as well as development of vaccines against SARS-CoV-2.

Recombinant antibody technology allows you to obtain highly reliable anti-immunoglobulin antibodies tailored to your specific assay. Recombinant production provides the highest possible batch-to-batch reproducibility, while antibody engineering can be used to increase antibody compatibility with other assay components and extend antibody utility beyond the original format. Moreover, all our antibodies are manufactured in a completely animal- and animal-component free production platform.

Our recombinant NHP immunoglobulin antibodies are available in formats such as human, mouse, and rabbit backbones, as well as antibody fragments. Other formats are available upon request and further targets will be added regularly – if there is anything specific you’re looking for and can’t find yet, please contact us.

View our NHP immunoglobulin antibodies below. If you are looking for secondary antibodies to human antibodies see here; for any other species, check out our page here. Finally, if you need primary antibodies with a non-human primate backbone, get in touch. Our entire recombinant antibody catalog is available in rhesus macaque and cynomolgus monkey IgG1 and IgG4 isotypes. If there is a particular antibody you cannot find in these formats, please contact us.

 

Antibody Name [Clone] Species Reactivity Catalog Number
Anti-Macaque pan-species IgG [1B3] Rhesus macaque; cynomolgus monkey; pigtailed macaque; baboon Ab01269
Anti-Pan-primate IgG [8F1] Human; non-human primates Ab01271
Anti-Rhesus IgA alpha chain [10F12] Rhesus macaque Ab01272
Anti-Marmoset IgG [4H12] Common marmoset; squirrel monkey Ab01273
Anti-Baboon IgG1 [7H4.G8.G10] Baboon Ab01619
Anti-Baboon IgG2 [1E11.1] Baboon Ab01620
Anti-Baboon IgG3 [4A6.1] Baboon Ab01621
Anti-Baboon IgG4 [5F3.E11.G4] Baboon Ab01622
Anti-Rhesus IgG1 [3C10.3] Rhesus Ab01623
Anti-Rhesus IgG4 [2C6] Rhesus Ab01624
Anti-Rhesus IgG4 [7A8] Rhesus Ab01625

Other Secondary Antibodies

The majority of secondary antibodies against antibodies from common research models such as mouse or rat are polyclonal antibodies made in goats or rabbits. These not only suffer from reproducibility issues, but also come with a considerable impact on animal welfare. At Absolute Antibody, all our antibodies, including our secondary antibodies, are manufactured in a recombinant, completely animal- and animal-component free production platform. We are able to offer recombinant anti-immunoglobulin antibodies against mouse or rat antibodies, as well as antibodies that bind rabbit, goat, dog, and elasmobranch (e.g. sharks, rays, skates) antibodies.

Anti-immunoglobulin antibodies are used as secondary antibodies to detect primary antibodies in methods such as western blot, immunohistochemistry, and immunofluorescence staining for microscopy or flow cytometry. Recombinant production provides highly reliable anti-immunoglobulin antibodies with the highest possible batch-to-batch reproducibility. In addition, recombinant antibody technology enables antibody engineering to open up new experimental possibilities.

 

We also offer secondary antibodies against human or other primate antibodies. If you are looking for another species or target, please contact us.

 

Antibody Name [Clone] Species Reactivity Catalog Number
Anti-Rat IgG [OX-59] Rat Ab00588
Anti-Rat antibody kappa light chains [OX-12] Rat Ab00581
Anti-Rabbit IgG [A10B] Rabbit Ab03007
Anti-Mouse antibody kappa light chain [OX-20] Mouse Ab00583
Anti-loggerhead IgY spliced chain [LH1] Loggerhead turtle; Green sea turtle; Kemp’s ridley turtle Ab02499
Anti-loggehead IgY heavy chain [LH-12-4] Sea turtles Ab02497
Anti-lambda light chain [8-H9] Ferret (Mustela putorius furo) Ab02372
Anti-lambda light chain [6-H5] Ferret (Mustela putorius furo) Ab02371
Anti-lambda light chain [4-D11] Ferret (Mustela putorius furo) Ab02370
Anti-kappa light chain [4-B10] Ferret (Mustela putorius furo) Ab02368
Anti-immunoglobulin [6-B5] Ferret (Mustela putorius furo) Ab02373
Anti-IgNAR [GA8] Elasmobranch Ab01553
Anti-IgM (Igh-Cb and related haplotypes) [AF6-78.25.4] Mouse Ab02574
Anti-IgG3 Fc [TP924] Mouse; Rabbit Ab01460
Anti-IgG2b Fab [TP984] Mouse Ab01459
Anti-IgG2b Fab [TP979] Mouse; Guinea pig Ab01458
Anti-IgG2a/3 Fc [TP929] Mouse; Rabbit (weak) Ab01461
Anti-IgG2a/2b Fc [TP925] Mouse Ab01457
Anti-IgG2a Fc [TP923] Mouse Ab01455
Anti-IgG2a Fc [TP922] Mouse Ab01454
Anti-IgG2a Fc [TP1129] Mouse Ab01453
Anti-IgG2a (hinge) [TP926] Mouse Ab01456
Anti-IgG1/2a/2b Fab (k) [TP1106] Mouse Ab01452
Anti-IgG1/2a Fab (k) [TP890] Mouse Ab01451
Anti-IgG1/2a Fab (k) [TP889] Mouse Ab01450
Anti-IgG1/2a Fab (k) [TP888] Mouse Ab01449
Anti-IgG1/2a Fab (k) [TP887] Mouse Ab01448
Anti-IgG1 Fc [TP895] Mouse Ab01445
Anti-IgG1 Fc [TP894] Mouse Ab01444
Anti-IgG1 Fc [TP884] Mouse; Rat (weak) Ab01443
Anti-IgG1 Fc [TP883] Mouse; Rat; Human (weak) Ab01442
Anti-IgG1 Fc [TP882] Mouse; Rat Ab01441
Anti-IgG1 Fc [TP881] Mouse; Rat (weak) Ab01440
Anti-IgG1 Fc [TP879] Mouse; Rat Ab01438
Anti-IgG1 Fc [TP878] Mouse Ab01437
Anti-IgG1 Fc [TP1107] Mouse; Rat; Human (weak) Ab01436
Anti-IgG1 Fc [TP1104] Mouse Ab01439
Anti-IgG1 Fab (k+l) [TP886] Mouse Ab01447
Anti-IgG1 (hinge) [TP885] Mouse; Rat Ab01446
Anti-IgG [GT175] Goat Ab01020
Anti-IgE [R1E4] Mouse Ab01115
Anti-IgE [mAbA9] Mouse Ab01158
Anti-IgE [D9#3116] Dog Ab01391
Anti-IgD (Igh-Ca haplotype) [AMS9- 9.1.1.1] Mouse Ab02573
Anti-Fc [TP897] Rabbit; Guinea pig; Human (weak) Ab01432
Anti-Fab [TP896] Rabbit Ab01431
Anti-Fab (lambda) [TP1014] Mouse; Rat; Rabbit (weak) Ab01435
Anti-Fab (kappa) [TP975] Mouse Ab01434
Anti-Fab (kappa) [TP1170] Mouse Ab01433
Anti-antibody heavy chain [6-B7] Ferret (Mustela putorius furo) Ab02374
Anti-antibody heavy chain [11-E3] Ferret (Mustela putorius furo) Ab02375
Anti-kappa light chain [4-E3] Ferret (Mustela putorius furo) Ab02369
Anti-chicken IgY [IgY 176] Chicken Ab02049
Anti-loggerhead IgY light chain [LH9] Sea turtles Ab02498
Anti-IgM [1.14] Trout Ab02046

Recombinant Proteins

Veterinary IgE Fc Proteins

IgE is an often overlooked antibody isotype, but it plays a critical role in allergic reactions and certain autoimmune diseases. To advance related research and diagnostics, Absolute Antibody has used recombinant antibody technology to develop highly reproducible IgE proteins in a wide range of species. These Fc-only proteins can be used for a variety of applications:

  • Assay standards: create reproducible control sera by spiking the IgE into normal sera
  • Immunogens: generate antibodies against the immunoglobulin Fc domain
  • Engineered into antigen-specific antibodies: make an IgE antibody for your allergy or autoimmunity research

New Species Available

We now offer IgE Fc domain proteins in a variety of species. We started with the common models, human and mouse, and have recently expanded our catalog to include animals such as dog, cat and horse. The new species are ideal for veterinary research and diagnostic assay design.

The IgE Fc domain proteins react with species-specific anti-IgE antibodies, with no cross-reactivity observed (see ELISA data below).

Currently available IgE Fc domain proteins are listed below. We also offer immunoglobin Fc domains in other subtypes, including IgG1, IgG2A, IgA and IgM; you can view our full list of Ig Fc domains here. For more information or to place an order, please contact us.

Interested in using these Fc proteins to create antigen-specific antibodies? Choose a target from our extensive catalog, or provide your own antibody, and we’ll do the rest. Check out our selection of anti-allergen antibodies, and contact us to discuss your project!

 

Catalog Number Product Name
Pr00104-14.5 Recombinant Human IgE-Fc domain
Pr00107-20.5 Recombinant Mouse IgE-Fc domain
Pr00344-39.5 Recombinant Dog IgE-Fc domain
Pr00343-38.5 Recombinant Cat IgE-Fc domain
Pr00345-40.5 Recombinant Horse IgE-Fc domain

Fc Fusion Proteins

Fc fusion proteins (also known as Fc chimeric fusion proteins, Fc-Igs, Ig-based chimeric fusion proteins and Fc-tag proteins) are composed of the Fc domain of IgG genetically linked to a peptide or protein of interest. Fc fusion proteins have become valuable reagents for in vivo and in vitro research.

Examples of Fc-fused binding partners include, but are not limited to, single peptides, ligands activated upon cell-surface receptor binding, signaling molecules, extracellular domains of receptors activated upon dimerization and bait proteins used to identify binding partners in protein microarrays.

One of the most valuable characteristics conferred by the Fc domain in vivo is the dramatic prolonging of the plasma half-life (t1/2) of the protein of interest, which for biotherapeutic drugs can result in improved therapeutic efficacy, an attribute that has made Fc fusion proteins attractive biotherapeutic agents.

n vitro applications of Fc fusion proteins include, among others, immunohistochemistry (IHC), flow cytometry (FC), protein binding assays and use as microarray baits. In these applications, the Fc domain behaves as a supporting module to which proteins can be attached while retaining their native biological activity. The Fc domain can also improve the in vivo and in vitro solubility and stability of some binding partners.

Absolute Antibody offer a diverse array of recombinant Fc fusion proteins with a range of species-specific and genetically engineered Fc domains such as Fc Silent™.

For further information or for bulk and custom orders, do not hesitate to contact us.

 

Catalog Number Product Name Recombinant Protein Species Immunoglobulin Fc domain Isotype and Species
Pr00246-10.9 Recombinant human NR3L1 Fc-Fusion Protein Human Human IgG1
Pr00245-10.9 Recombinant human FCRL6 Fc-Fusion Protein Human Human IgG1
Pr00244-10.9 Recombinant humanBY55 Fc-Fusion Protein Human Human IgG1
Pr00243-10.9 Recombinant human TIMG2 Fc-Fusion Protein Human Human IgG1
Pr00242-10.9 Recombinant human TMM81 Fc-Fusion Protein Human Human IgG1
Pr00241-10.9 Recombinant human NCAM1 Fc-Fusion Protein Human Human IgG1
Pr00240-10.9 Recombinant human LINGO2 Fc-Fusion Protein Human Human IgG1
Pr00239-10.9 Recombinant human LAIR2 Fc-Fusion Protein Human Human IgG1
Pr00238-10.9 Recombinant human LAIR1 Fc-Fusion Protein Human Human IgG1
Pr00237-10.9 Recombinant human HAVCR1 Fc-Fusion Protein Human Human IgG1
Pr00236-10.9 Recombinant human CADM1 Fc-Fusion Protein Human Human IgG1
Pr00235-10.9 Recombinant human AMIGO3 Fc-Fusion Protein Human Human IgG1
Pr00234-10.9 Recombinant human CD70 Fc-Fusion Protein Human Human IgG1
Pr00233-1.9 Recombinant mouse 4-1BB Fc-Fusion Protein Mouse Mouse IgG1
Pr00232-1.28 Recombinant mouse TL1A Fc-Fusion Protein Mouse Mouse IgG1
Pr00231-1.9 Recombinant mouse CD155 Fc-Fusion Protein Mouse Mouse IgG1
Pr00230-1.9 Recombinant mouse CD96 Fc-Fusion Protein Mouse Mouse IgG1
Pr00228-1.9 Recombinant mouse TIM-3 Fc-Fusion Protein Mouse Mouse IgG1
Pr00227-1.9 Recombinant mouse TIM-1 Fc-Fusion Protein Mouse Mouse IgG1
Pr00226-1.9 Recombinant mouse CD86 Fc-Fusion Protein Mouse Mouse IgG1
Pr00225-1.9 Recombinant mouse CD80 Fc-Fusion Protein Mouse Mouse IgG1
Pr00224-1.9 Recombinant mouse BTLA Fc-Fusion Protein Mouse Mouse IgG1
Pr00223-1.9 Recombinant mouse HVEM Fc-Fusion Protein Mouse Mouse IgG1
Pr00206 Recombinant mouse CD52-Fc Fusion Protein Mouse Mouse IgG1
Pr00188-10.9 Recombinant human SLAF6 Fc-Fusion Protein Human Human IgG1
Pr00187-10.9 Recombinant human TNR4 Fc-Fusion Protein Human Human IgG1
Pr00186-10.28 Recombinant human CD69 Fc-Fusion Protein Human Human IgG1
Pr00185-10.9 Recombinant human SEM4D Fc-Fusion Protein Human Human IgG1
Pr00183-10.9 Recombinant human NKG2-F Fc-Fusion Protein Human Human IgG1
Pr00182-10.9 Recombinant human TNR9 Fc-Fusion Protein Human Human IgG1
Pr00181-10.9 Recombinant human CEACAM1 Fc-Fusion Protein Human Human IgG1
Pr00180-10.9 Recombinant human SLAF7 Fc-Fusion Protein Human Human IgG1
Pr00179-10.9 Recombinant human CD27 Fc-Fusion Protein Human Human IgG1
Pr00178-10.9 Recombinant human PTPRC Fc-Fusion Protein Human Human IgG1
Pr00164-1.9 Recombinant mouse VISTA Fc-Fusion Protein Mouse Mouse IgG1
Pr00163-1.9 Recombinant mouse TIGIT Fc-Fusion Protein Mouse Mouse IgG1
Pr00162-1.9 Recombinant mouse Lag3 Fc-Fusion Protein Mouse Mouse IgG1
Pr00161-1.28 Recombinant mouse CD70 Fc-Fusion Protein Mouse Mouse IgG1
Pr00160-1.9 Recombinant mouse CD27 Fc-Fusion Protein Mouse Mouse IgG1
Pr00159-1.28 Recombinant mouse 4-1BBL Fc-Fusion Protein Mouse Mouse IgG1
Pr00158-1.9 Recombinant mouse B7-H3 Fc-Fusion Protein Mouse Mouse IgG1
Pr00157-1.9 Recombinant mouse ICOSL Fc-Fusion Protein Mouse Mouse IgG1
Pr00156-1.9 Recombinant mouse PDL2 Fc-Fusion Protein Mouse Mouse IgG1
Pr00155-1.9 Recombinant mouse CTLA4 Fc-Fusion Protein Mouse Mouse IgG1
Pr00154-1.9 Recombinant mouse OX40 Fc-Fusion Protein Mouse Mouse IgG1
Pr00153-1.9 Recombinant mouse ICOS Fc-Fusion Protein Mouse Mouse IgG1
Pr00152-1.9 Recombinant mouse PD-1 Fc-Fusion Protein Mouse Mouse IgG1
Pr00136 Recombinant human CTLA-4 Fc-Fusion Protein (Abatacept) Human Human IgG1
Pr00135 Recombinant human TNFR1B Fc-Fusion Protein (Etanercept) Human Human IgG1
Pr00128-10.28 Recombinant human NKG2E Fc-Fusion Protein Human Human IgG1
Pr00127-10.9 Recombinant human NCTR1 Fc-Fusion Protein Human Human IgG1
Pr00126-10.9 Recombinant human NCTR3 Fc-Fusion Protein Human Human IgG1
Pr00125-10.28 Recombinant human NKG2D Fc-Fusion Protein Human Human IgG1
Pr00124-10.9 Recombinant human CD96 Fc-Fusion Protein Human Human IgG1
Pr00123-10.9 Recombinant human CD226 Fc-Fusion Protein Human Human IgG1
Pr00122-10.9 Recombinant human TIGIT Fc-Fusion Protein Human Human IgG1
Pr00117-10.9 Recombinant human EGFR Fc-Fusion Protein Human Human IgG1
Pr00113-1.9 Recombinant mouse CD47 (C33 to G mutation) Fc-Fusion Protein Mouse Mouse IgG1
Pr00112-1.9 Recombinant mouse PDL1 Fc-Fusion Protein Mouse Mouse IgG1
Pr00111-1.9 Recombinant mouse TNFR1 Fc-Fusion Protein Mouse Mouse IgG1
Pr00109-1.9 Recombinant mouse IL2 Fc-Fusion Protein Mouse Mouse IgG1
Pr00103-10.13 Recombinant Human CTLA-4 Fc Silent™-Fusion Protein Human Human IgG1 Fc Silent™ mutations in the Fc
Pr00103-10.9 Recombinant Human CTLA-4 Fc-Fusion Protein Human Human IgG1
Pr00439 Recombinant Human ACE2-IgG Fc (LALA)-Fusion Protein Human Human IgG1 (with silencing LALA mutations)
Pr00441 Recombinant Human ACE2-NN-IgG Fc (LALA)-Fusion Protein Human Human IgG1 (with silencing LALA mutations)
Pr00251 Recombinant S1-camel Fc-Fusion Protein MERS Camel
Pr00118-1.9 Recombinant IL-13 Fc-Fusion Protein Mouse Mouse IgG1
Pr00510-1.9 Recombinant CD40 Fc-Fusion Protein Mouse Mouse IgG1
Pr00511-10.9 Recombinant CD40 Fc-Fusion Protein Human Human IgG1
Pr00512-201.9 Recombinant CD40 Fc-Fusion Protein Dog Dog IgG2
Pr00513-201.9 Recombinant PD1 Fc-Fusion Protein Dog Dog IgG2
Pr00514-201.9 Recombinant PDL1 Fc-Fusion Protein Dog Dog IgG2
Pr00515-201.9 Recombinant ICOS Fc-Fusion Protein Dog Dog IgG2
Pr00516-201.9 Recombinant CTLA4 Fc-Fusion Protein Dog Dog IgG2

Immunoglobulin Fc domains (Ig Fc domains)

Figure 1. A schematic representation of the structure of four immunoglobulin (Ig) classes or isotypes and their Fc domains. The Ig Fc domain does not bind antigen- see Antibody Isotypes and Subtypes and Antibody Effector Functions for a detailed account on structure and function of antibodies.

We offer a range of isotype- and species-specific Ig Fc domains – please see the table below.

Recombinant Ig Fc domains are recommended as:

  • Assay standards or controls (see IgG Fc Fusion Proteins)
  • Immunogens to generate antibodies against the immunoglobulin Fc domains and other Ig Fc domain applications

For further information or to request a species or isotype not yet shown, please contact us.

 

Catalog Number Product Name
Pr00100-10.5 Recombinant Human IgG1-Fc domain
Pr00101-1.5 Recombinant Mouse IgG1-Fc domain
Pr00102-2.5 Recombinant Mouse IgG2A-Fc domain
Pr00104-14.5 Recombinant Human IgE-Fc domain
Pr00105-16.5 Recombinant Human IgA-Fc domain
Pr00107-20.5 Recombinant Mouse IgE-Fc domain
Pr00108-15.5 Recombinant Human LMW IgM-Fc domain (monomeric)
Pr00343-38.5 Recombinant Cat IgE-Fc domain
Pr00344-39.5 Recombinant Dog IgE-Fc domain
Pr00345-40.5 Recombinant Horse IgE-Fc domain

Multi-Tag Control Proteins

Absolute Antibody’s Multi-Tag control protein (Pr00106) and Multi-Tag control protein 2 (Pr00565) are genetically engineered synthetic fusion proteins composed of commonly used epitope tags fused together using flexible linkers (Figure 1 and 2). These Multi-Tag synthetic fusion proteins can be used as a positive control in western/dot blots and ELISAs.

You can also check out our epitope tags page for our full range of recombinant and chimeric anti-epitope tag monoclonal antibodies. For further information on our Multi-Tag control proteins or any of our products, contact us and we will be happy to help.

Figure 1: A schematic representation of the Absolute Antibody’s Multi-Tag control protein (Pr00106), composed of 17 commonly used epitope tags shown in sequence from N- to C-terminal.

Figure 2: A schematic representation of the Absolute Antibody’s Multi-Tag control protein 2 (Pr00565), composed of 12 commonly used epitope tags shown in sequence from N- to C-terminal.

Table 1: List of tags found in Pr00106 and Pr00565.

Multi-Tag control protein (Pr00106) Multi-Tag control protein 2 (Pr00565)
Thioredoxin (Trx) tag SDKIIHLTDDSFDTDVLKADGAILVDF

WAEWCGPCKMIAPILDEIADEYQGK

LTVAKLNIDQNPGTAPKYGIRGIPTLLL

FKNGEVAATKVGALSKGQLKEFLDAN

LA

 MBP tag MKIEEGKLVIWINGDKGYNGLAEVGKKFE

KDTGIKVTVEHPDKLEEKFPQVAATGDGP

DIIFWAHDRFGGYAQSGLLAEITPDKAFQ

DKLYPFTWDAVRYNGKLIAYPIAVEALSLI

YNKDLLPNPPKTWEEIPALDKELKAKGKS

ALMFNLQEPYFTWPLIAADGGYAFKYEN

GKYDIKDVGVDNAGAKAGLTFLVDLIKNK

HMNADTDYSIAEAAFNKGETAMTINGP

WAWSNIDTSKVNYGVTVLPTFKGQPSKP

FVGVLSAGINAASPNKELAKEFLENYLLTD

EGLEAVNKDKPLGAVALKSYEEELAKDPRI

AATMENAQKGEIMPNIPQMSAFWYAVR

TAVINAASGRQTVDEALKDAQTNSSSNN

NNNNNNNNLGIEGR
T7 tag CMASMTGGQQMG GCN4 tag HLENEVARLKK
HSV tag QPELAPEDPEDC MAP-tag GDGMVPPGIEDKIT
VSV-g tag YTDIEMNRLGKG Protein C tag EDQVDPRLIDGK
Glu-Glu tag CEEEEYMPME Rap-tag GDDMVNPGLEDRIEC
V5-tag GKPIPNPLLGLDST Rho-tag TETSQVAPA
E-tag GAPVPYPDPLEPR Alpha-tag SRLEEELRRRLTE
HA tag YPYDVPDYAC Rim-tag PLHPRTAGASR
FLAG tag DYKDDDDK Softag SLAELLNAGLGGS
GST tag

 

 PILGYWKIKGLVQPTRLLLEYLEEKYEE

HLYERDEGDKWRNKKFELGLEFPNLP

YYIDGDVKLTQSMAIIRYIADKHNML

GGCPKERAEISMLEGAVLDIRYGVSRI

AYSKDFETLKVDFLSKLPEMLKMFED

RLCHKTYLNGDHVTHPDFMLYDALD

VVLYMDPMCLDAFPKLVCFKKRIEAI

PQIDKYLKSSKYIAWPLQGWQATFG

GGDHPPKSDLV

 Strep tag WSHPQFEK
Myc tag EQKLISEEDLC His tag HHHHHH
S-tag KETAAAKFERQHMDS Pep tag AVERYLKDQQLLGIW
KT3 tag KPPTPPPEPET
E2-tag GVSSTSSDFRDR
AU1 tag DTYRYI
AU5 tag TDFYLK
His tag HHHHHH
Catalog Number Product Name
Pr00106 Multi-Tag Control Protein
Pr00565 Multi-Tag Control Protein 2

Recombinant Free Light Chains

Free antibody light chains are important diagnostic markers for a range of disorders including amyloidosis, various myelomas and lymphomas. Absolute levels as well as imbalances in the ratio of free kappa and lambda chains are used as diagnostic and prognostic markers.

The recombinant expression platform used by Absolute Antibody allows the direct expression of free antibody light chains, overcoming the common problems faced in purifying these proteins. Our serum-free culturing system and affinity purification result in ultra-pure product that may be used as calibrators and positive controls for diagnostic assays.

We offer both lambda and kappa light chains.

For larger quantities or more information, please contact us and we will be happy to help you.

Coomassie-stained SDS-PAGE gel of human recombinant free lambda (left) and kappa (right) light chains. Starting from the tissue culture supernatant, a single purification step was perfomed to enrich for recombinant free light chains, both as monomer and dimer (at around 28 and 50 kDa, respectively).

Catalog Number Product Name
Pr00115 Recombinant Human Free Kappa Light Chain
Pr00116 Recombinant Human Free Lambda Light Chain

SERVICES

Antibody Sequencing

Good, validated antibodies are highly valuable, but hybridomas are easily lost. Storage accidents, genetic drift or contamination can threaten the security of your antibody.

One solution is to sequence your antibody to enable recombinant production. Sequencing an antibody is vital when obtaining intellectual property rights for your sequence, and expands your antibody’s potential with antibody engineering options.

Hybridoma Sequencing

Absolute Antibody offers a quick and professional hybridoma sequencing service, also known as antibody sequencing. Hybridoma sequencing is the sequencing of the cDNA encoding the variable heavy (VH) and variable light (VL) domains of your hybridoma cell line.

Sequencing the antibody genes of your hybridoma offers many advantages:

  • Security – your antibody can always be produced recombinantly even if your hybridoma line is lost
  • Humanization – once you know the VH and VL sequences you can proceed to humanization if part of a therapeutic antibody project
  • Flexibility – convert your antibody to any species, isotype or format
  • Intellectual property – patent the sequences of your unique variable domains

Contact us to receive a quote or to discuss your requirements in more detail.

 

Guaranteed Antibody Sequencing Service

5,000+ hybridomas sequenced.

Our method – The mRNA transcriptome is obtained from the hybridoma and random hexamers are used to generate a cDNA library. This is fragmented, and undergoes paired-end sequencing. The sequencing reads are assembled into contigs, from which antibody transcripts are identified based on homology.

At Absolute Antibody we perform high throughput (NGS) hybridoma sequencing. In 4-6 weeks, we deliver you all VH and VL sequences as well as a full report characterizing your hybridoma’s sequences and any heterogenicity or other antibody isotypes that might be present.

  • Works on any species or isotype
  • Use of random primers means that no mutations are introduced
  • Identifies all HC and LC sequences and quantifies their relative abundance
  • No sequence, no fee for any viable hybridoma
  • Your sequence is your property – all our services are royalty-free
  • High-throughput method can sequence up to 50 hybridomas concurrently – bulk hybridoma sequencing packages available
  • Sequence delivered in 4-6 weeks

Even if a hybridoma is contaminated or unproductive, we could be able to save your antibody for recombinant expression. Review our collection of hybridoma sequencing case studies to learn how our unique NGS method can help overcome such obstacles to antibody production. Contact us about your project to see if we can help.

If you want to sequence a large hybridoma collection or your entire antibody catalog, contact us to discuss our bulk hybridoma sequencing options.

If you want to sequence antibody directly from purified protein, read about our protein sequencing service.

We also provide follow on services – read our antibody engineering and antibody expression pages for more information.

We provide instructions for shipping hybridoma cell lines in your order quote. You may request a free SeqPack™ Hybridoma Preservation Kit if you do not wish to ship using dry ice.

Please contact us to learn more about our hybridoma sequencing and request an order quote. Bulk discounts may apply.

Antibody Protein Sequencing

There are many monoclonal antibodies for which the hybridoma cell line is unavailable. To complement our hybridoma sequencing service, we are also offering a de novo antibody protein sequencing service.

By combining mass spectrometry with high accuracy de novo peptide sequencing and assembly of overlapping peptides, the amino acid sequences of the variable domains are determined.

We guarantee to deliver a functional antibody sequence along with a comprehensive sequencing report with full sequence coverage. In combination with our transient expression service, we can sequence an antibody and deliver recombinant versions in as little as 9 weeks.

De novo sequencing workflow: The antibody is digested using multiple enzymes. On each digest LC-MS-MS is performed and peptides predicted de novo. Using proprietary software, overlapping peptides are assembled into a full coverage protein sequence.

 

Customer Provides Mass Spectrometric Sequencing Antibody Expression Timeline Deliverables
Monoclonal antibody, >0.1 mg, 95% pure
  • Enzymatic digest into overlapping peptides
  • LC-MS/MS using Thermo Orbitrap
  • De novo identification of peptides
  • Automated peptide assembly
  • Curation of results by experienced scientists
  • Gene synthesis
  • Cloning
  • Transient expression in HEK293 cells
  • Affinity purification
  • Buffer exchange (PBS)
  • Sterile filtration
  • Purity >96% (SDS-PAGE)
  • Endotoxin < 1 EU/mg
 9 weeks
  • Comprehensive sequencing report
  • 3 mg purified antibody
  • QC data

Polyclonal Antibody Sequencing

Polyclonal antibodies are widely used reagents across research and diagnostics. They are generated by immunizing animals with an immunogen and harvesting the animals’ blood to obtain immunoreactive serum. While polyclonal antibodies offer a range of advantages such as excellent performance across different methods, they suffer from high batch-to-batch variability and require the continued use of animals for their production.

Turning a polyclonal antibody into an infinitely reproducible recombinant antibody has been described as the Holy Grail of reagent antibody technology with far-reaching potential. Now, advances in antibody protein sequencing technology have made it possible to sequence a polyclonal antibody protein sample and obtain highly functional recombinant monoclonal antibodies from the sequence.

Absolute Antibody has partnered with leading industry innovators, including Rapid Novor and Abterra Bio, to enable the production of animal-free polyclonal reagents that are both reproducible and in unlimited supply. Our partners have pioneered the cutting-edge sequencing technology, while Absolute Antibody provides the antibody expression expertise to recombinantly produce monoclonal antibodies from the sequences. We also offer confirmation of binding compared to the original polyclonal antibody, as well as the expression of multiple clones to create an antibody mixture.

We partnered with Rapid Novor to sequence and express monoclonal antibodies from a polyclonal goat antibody sample

Reporting the de novo sequencing of monoclonal antibodies from a polyclonal goat antibody sample by mass spectrometry, followed by recombinant expression and testing. To our knowledge, this is the first report of a successful conversion of a goat polyclonal to a monoclonal using just antibody protein as a template.

We believe that with continual validation, polyclonal antibody sequencing will have a profound impact on the research reagents and diagnostics industry. It also shows great potential for the development of therapeutics from existing polyclonal antibodies. In addition to guaranteeing long-term reproducibility, sequencing a polyclonal antibody enables researchers to extend the usefulness of their original antibody through engineering. Our antibody engineering services allow for a wealth of possibilities, including species and isotype switching, or the creation of novel formats such as high avidity fragments or multispecific antibodies.

If you have a polyclonal antibody you would like to immortalize into a precisely defined and reproducible reagent, please contact us to learn more about our polyclonal antibody sequencing service. The service is ideal for immortalizing challenging immunizations and researchers interested in pushing the boundaries of recombinant antibody technology.

Antibody Engineering Services

At Absolute Antibody we have developed a proprietary cloning system to enable rapid reformatting of antibodies into almost any format. Our antibody engineering services include chimerization, humanization, isotype switching and the manufacturing of recombinant antibody fragments and bispecific antibodies. For more information about any of these services, please follow the links, download our Guide to Antibody Engineering white paper, or get in touch – we’re happy to help.

The following species, isotypes and formats are currently available at Absolute Antibody with more coming soon. For more details about the unique formats we can custom engineer for clients, check out our Periodic Table of Antibodies.

Antibody formatHumanMouseRatHamsterRabbitGoatRhesusCynoSheepDogPigFerret
IgG✓✓✓✓✓✓✓✓✓✓✓✓
IgA✓✓✓✓
IgE✓✓✓
IgM✓✓✓✓✓✓
Fc domains✓✓
Fabs✓✓
Fab2✓✓
Fc fusions✓✓✓
Bispecifics✓✓

Other Species

If you require antibodies of a species not listed, please do not hesitate to ask. Currently we have antibody sequences available for a large number of animals ranging from pig, sheep, horse, dog, chicken, fish, platypus and a whole range of non-human primates. Moreover, our in-house experts are able to determine antibody sequences from most genomes (even if only partial assemblies are available). If you are looking for something very unusual, please contact us.

Chimerization

We offer an antibody chimerization service which enables you to create a chimeric antibody, consisting of the original variable domains from your antibody with the constant domains from a different species, for almost any mammalian species. In particular, we offer chimerization of human, mouse, rat, rabbit and hamster IgG with other species and isotypes available by request. For more information, please visit our dedicated page on chimeric antibodies or contact us.

Humanization

We offer a royalty-free antibody humanization service. For more information, please see our dedicated page on antibody humanization or contact us.

Isotype switching

Our isotype switching service (also known as class switching) allows you to alter the isotype or subtype of any antibody. This can be used to alter the in vivo effector function and stability of an antibody. Equally, some antibody subtypes are prone to aggregation. Switching the isotype/subtype can help overcome this. Or perhaps you would like to convert your IgG to an IgM for increased avidity? We can offer all these things and more. For more information or to request a quote, contact us.

Antibody fragments

In certain situations antibody fragments offer an ideal alternative to full-length antibodies. Our proprietary recombinant expression and antibody engineering platform enables us to convert any antibody into a fragment, such as a single chain Fv (scFv), Fab or Fab2, followed by expression and purification at any scale. For more information, please visit our dedicated page on antibody fragments or contact us. For a general information guide on the types and uses of fragments, please see our Absolute Antibody resource page on antibody fragments.

Bispecific antibodies

Absolute Antibody offers a bispecific antibody service. We can reformat any pair of antibodies into an IgG-scFv format (i.e. an IgG with a scFv fused to the C-terminus of the IgG). This results in a bispecific bivalent antibody format capable of binding two antigens simultaneously. For more information, see our dedicated page on bispecific and trispecific antibodies or to request a quote please contact us.

Engineered Fc domains

Absolute Antibody can engineer the Fc domain of your antibody to mediate effector function or extend the plasma half-life. For example, we can abolish Fc domain binding to FcγR using our Fc Silent™ mutation or mAbsolve’s STR mutations, as well as extend or shorten the plasma half-life of your IgG antibody by introducing mutations in the Fc domain.

And more.

Below is a selection of the formats we have engineered for our customers. Contact us with your ideas – we’ll see what we can do! You can explore our interactive Periodic Table of Antibodies

Antibody Expression Services

Our antibody expression platforms rapidly produce high-quality, animal-free recombinant antibodies at milligram-to-gram scale in HEK or CHO cells. Our serum-free mammalian transient expression system offers a faster, more affordable alternative to stable cell line generation, and we’ve used it to manufacture recombinant antibodies in any species, isotype or format with high purity and low endotoxin levels.

Depending on your antibody expression needs, we are a reliable outsourcing solution for antibody production, or a true consultative partner for developing the best possible engineered antibody. All production occurs at our ISO 9001:2015-certified manufacturing facility, which enables high-throughput capacity and the ability to scale up to multi-gram quantities within weeks.

We have experience manufacturing antibodies for clients worldwide, including pharmaceutical and biotechnology companies, diagnostic assay developers and academic researchers. We have produced more than 21,000 different recombinant antibodies, making 865 grams of protein in total and expanding our all-recombinant reagents catalog to more than 13,500 antibodies. As illustrated by our Periodic Table of Antibodies, we’ve manufactured more than 180 different antibody formats to date, including multispecific antibodies, fragments and Fc fusion proteins.

Our antibody expression services are all royalty-free and customizable to your needs. We can start from an electronic antibody sequence, hybridoma cell line or purified antibody protein. In addition, your project will be supported by scientific staff with deep expertise in antibody development, a dedicated project manager, and a global customer service team across North America, Europe and Asia.

Read about all our different antibody expression services below. To learn more, contact us.

HEXpress™ HEK Antibody Production

Our HEXpress™ service produces milligram-to-gram quantities of recombinant antibodies in HEK cells with high purity and low endotoxin levels. This service provides a faster, more affordable alternative to stable cell line generation, with proven expression of antibodies in any species, isotype or format.

CHXpress™ CHO Antibody Production

Our CHXpress™ service enables serum-free mammalian transient expression in CHO cells to better serve clients through their full antibody development. This service is particularly useful for bridging the gap to stable CHO production, or for tackling challenging constructs.

FleXpress™ High-Throughput Antibody Production

Our FleXpress™ service allows clients to rapidly express large numbers of IgG antibodies at 80 ml scale using our proven recombinant antibody technology. This service is particularly useful for early-stage pilot studies on a group of therapeutic antibody candidates, as well as converting a monoclonal antibody portfolio from hybridomas to recombinant production.

Improve your Flow Cytometry with FIX&PERM® Buffers and Recombinant Engineered Antibodies

Contact UsView All Products You have gone to great lengths to collect and suspend your cellular sample, and as antibody Read More...

Murine Bispecific Antibody Reagents

Contact UsView All Products Bispecific antibodies are an exciting class of therapeutics permitting simultaneous engagement of two distinct targets with Read More...

Supporting Cancer Immunotherapy Research: Recombinant, Syngeneic Antibodies Against Mouse PD-1

Contact UsView All Products Immunotherapy is an exciting strategy for the treatment of cancer, designed to re-activate and enhance anti-tumor Read More...